(data stored in ACNUC9543 zone)

EMBL: AL844507.PE77

AL844507.PE77        Location/Qualifiers
FT   CDS_pept        join(409936..414330,414472..414709,414972..415168)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808100"
FT                   /product="AP-3 complex subunit delta, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0808100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.123:mRNA"
FT                   /db_xref="GOA:C0H4T0"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017105"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4T0"
FT                   /protein_id="CAX64106.1"
FT                   /translation="MDNSFVELIKDIKKDDSINNLEKNYQKCVSYLKDLDKRKSNDKLF
FT                   LMNSVVKEKSLVLLKLLYLQMFGKKIDKEYNFSVIQLLTCNKYFLKRRGFFFLNSISDN
FT                   DDIIFLSINLFKKELYKDSINSIDQNTKGTVLSSLSNIGTKIIKENINIFKNMNTINTN
FT                   NVNTINTNNVNTTNTNNVNTINTNNMNTINTNNMNTINTNNMNTINTNNMNTINTNNMN
FT                   NFHVNNSVEPFNDRNKKNNFSGLLQGINTNNDQKVFNTFLILNSISNICTDIMSSNLYN
FT                   DIFFLLNNSNVYIRKKTILCFYKLVISNLSILHTFFDLLKKNFVSLYNNENTSYEKLPF
FT                   DKVDYTFRNNTCLCCLIINVLAEIFSYLERRQMKYHNSPIRSNEYRERDLNLVGTNKKK
FT                   NDEQVCVHNKSDYCDNTNYYNSMLKNNEKIFHQVGTQKGEEIGLDHDNIKNNNNEIYSD
FT                   TCSNNNFYNDEHDISNYLKKFLSFVPFIYNILNERLSIIDNWKLIKFIKFINKLVKYEY
FT                   RIYKKFLPIIIHIYFTNKAKSVIFECYDFILFNYKKNYNVHIPNVDSYINTSVLSQEMC
FT                   GMFKCVDTSNDIKNVEEVKYNDKYNDKCNHNDVMVNHSNVDGTIQRTSSYNKHNINNPE
FT                   DVVLLSQEHINTYNIIYKEEKNTKENNNAGTPFDKFLFYCFKQLLSSFFTEDKNIVYMT
FT                   INLYKYLFIIPDIYEYFTRYNLLNEFSRNILKNFYHKDITIRKKLLYILYFLINDKNFE
FT                   QIVYSILIYLYNHNNNSYNNAEAKPLNYADEYINVIINYCINNLNNLQNVNVYVFILFY
FT                   LLCLKNHTKEYDILQHIHKINKKLKITHITTNFLSCIFIITYALGFIKDTLERNHLYLK
FT                   NNKLEMNKFFLTKCIQKNDHNIKHKNMDTNINIKTNEHVCFHTNTYKCSYNNIIQVGDP
FT                   FTKLICPSIEFNKKKDNLINKLNNQDDSYFLDIMSNYEEIYEYILINDIFNLKKEIKNF
FT                   NILNKYDVFEYIIIILKLYDKIYPDAKYIECVRETSQNGDPLNLKREMKENCENVKEKY
FT                   DDKNIQMNEDGDKYSDNYIKTCEYIKCNKLDHIKVESYEYIIYFITIYLEETYDKIKEF
FT                   KDMFFLKLFFFTLYLFFISYNSANILWNVIKIFMFFLQFEENHSLLLFYFYRCYTHLNY
FT                   LIKKKNDVYNLDTCILLKNILSLLLNTKKENYKTFNFYNYFINTIHIQENDNKHLDLNQ
FT                   PFKYDDSFFFFNSIVLSKEQSGTINKKKNKNIKNIKDDMDNNTSYNMPNIQKVTKKNIQ
FT                   TNITNELYILINKHEQYKQKWINTFPFYIIYQNDHFKLYLKHLKDNKQLILYIHLKNDT
FT                   FILNNFNLYTSFNLINYNILDKYNPDYTNFNDDVENYFYKYNNITIQKMDDYNHPINNK
FT                   NVIQIKNITRSIFISIKYDTYISDIKFCYDYFFNTQNVQNKGLLIIPYVKMDPLHLSTE
FT                   DFKRVNSKNVMLRNVNYEITTEKNSNIYKLLFNYFLFLSQYLNISFFNMNNIFVNLKNE
FT                   VQMNELRIIFCICESTKKSMSTLEDNIVLLLNVKPQKKEESNISYNYNIYIKMKILNNS
FT                   QDDSNKLLDYFEFYIKQLFLQKIINIDFSF"
     atggataata gttttgttga attaataaaa gatataaaaa aagatgacag tattaataat        60
     ttggaaaaga attatcagaa gtgtgttagt tatttgaagg atttggataa gaggaaatca       120
     aatgataagt tgtttttaat gaattcagtt gttaaagaga aatctttagt attattgaaa       180
     ttattatact tacaaatgtt tggaaaaaaa attgataagg aatataattt ttctgtaatc       240
     cagttattaa catgtaataa atatttttta aaaagacgtg gttttttttt tttgaatagt       300
     attagtgata atgacgatat aattttttta tccataaatt tatttaagaa ggaattatat       360
     aaagattcta taaattctat agatcaaaat acaaaaggta cagtattaag ttctctgtcc       420
     aatataggta ccaagataat aaaagaaaat attaatatat ttaaaaatat gaacacaatc       480
     aacacaaata atgtgaacac aatcaacaca aataatgtga acacaaccaa cacaaataat       540
     gtgaacacaa tcaacacaaa taatatgaac acaatcaaca caaataatat gaacacaatc       600
     aacacaaata atatgaacac aatcaacaca aataatatga acacaatcaa cacaaataat       660
     atgaacaatt tccatgttaa taattctgtt gaacctttta atgatagaaa taaaaaaaat       720
     aatttcagtg gcctccttca aggtattaat actaacaatg atcaaaaagt ttttaataca       780
     tttttaatat taaatagtat tagtaatata tgtactgata ttatgagtag taatttatac       840
     aatgatatat ttttcctttt aaataattcg aatgtatata ttaggaagaa aactatttta       900
     tgtttttata aattagtaat atcaaattta agcattttac atactttttt tgatttgtta       960
     aaaaaaaatt ttgtttcatt gtataataat gaaaatactt cctatgaaaa attacctttt      1020
     gacaaagttg attatacatt cagaaataac acatgtttgt gttgtttaat aattaatgtg      1080
     ctcgcagaaa tattttcata tttggagaga aggcaaatga aatatcacaa ctcacctatt      1140
     agaagcaatg aatatagaga aagagatctt aatctcgtgg gcacgaataa aaaaaaaaac      1200
     gatgaacaag tttgcgttca taataaaagt gattattgtg ataatacgaa ttattataat      1260
     agtatgctta agaataatga gaaaatcttt caccaggttg gaacacaaaa aggtgaagaa      1320
     attggactcg accatgataa tattaaaaat aataataatg aaatttatag tgatacttgt      1380
     agtaataata atttttataa tgatgaacat gatatttcta attatttaaa gaaattttta      1440
     tcctttgttc catttattta taacatattg aatgaaagat taagtattat agataattgg      1500
     aagctaatta aattcattaa atttattaat aaattagtaa aatatgaata cagaatatat      1560
     aaaaagttcc tacccataat tattcatatc tactttacaa acaaagcaaa gagcgttatt      1620
     tttgaatgct acgattttat actttttaat tataagaaaa attataatgt ccatatcccc      1680
     aacgtggata gttatattaa tacatctgtg ttatctcagg aaatgtgtgg tatgtttaaa      1740
     tgtgtggaca catccaacga tatcaaaaat gtcgaggagg taaaatataa tgataaatat      1800
     aatgataaat gtaatcataa tgacgttatg gtgaaccata gtaatgttga tggtactatc      1860
     caaagaacca gtagttataa taaacacaat attaacaatc cagaagatgt tgtattatta      1920
     tcacaagaac atataaatac atacaatatt atttacaaag aagaaaagaa taccaaagaa      1980
     aacaataatg ctggaacacc ttttgataaa tttttatttt attgttttaa acaattatta      2040
     tcatcttttt ttacagaaga taaaaatatt gtatacatga ccatcaattt gtataaatat      2100
     ctttttatta ttccagatat atatgaatat tttacacgtt acaatttatt aaatgaattt      2160
     tcaagaaata tattaaaaaa tttttatcac aaagatataa cgataagaaa aaagttatta      2220
     tatatattat attttttaat aaatgacaaa aatttcgaac aaattgttta tagcatattg      2280
     atctatttat ataatcataa caataattct tataataacg cagaagcgaa accattgaat      2340
     tatgccgatg aatatattaa tgttataatt aattattgta ttaataattt aaataattta      2400
     caaaatgtaa atgtgtatgt ttttatatta ttctatttat tatgtttaaa aaatcataca      2460
     aaagaatatg atatacttca acatatacat aaaataaata aaaagttaaa aataacacac      2520
     atcacaacca attttttaag ttgcattttt attataacat atgcattagg ttttataaaa      2580
     gatactttag aaagaaatca tttatatcta aaaaataata aattagaaat gaacaaattt      2640
     ttcttgacaa aatgtataca aaagaatgat cataatataa aacataaaaa tatggacaca      2700
     aatattaata taaaaaccaa tgaacatgta tgttttcata caaatactta taaatgttct      2760
     tataataata taatacaagt aggagatccg tttacaaaat taatatgtcc ctctattgag      2820
     tttaataaaa aaaaagataa tcttataaac aaattaaata atcaagatga tagttatttt      2880
     cttgacatca tgtcaaatta tgaagaaata tacgaatata tacttataaa cgatattttt      2940
     aatttaaaaa aagaaataaa aaatttcaat atattaaata aatatgatgt atttgaatat      3000
     attattatta ttttaaaatt gtatgataaa atatatcctg atgcaaagta catcgaatgt      3060
     gtacgagaaa catcacagaa tggtgatcct ttaaatctaa aaagagaaat gaaagaaaat      3120
     tgtgaaaatg taaaagaaaa atatgatgat aagaatatac aaatgaatga agatggtgat      3180
     aaatatagtg ataattatat taaaacatgt gaatatataa aatgtaacaa attagatcat      3240
     ataaaagtag aatcatatga atatataata tattttatta ctatctattt agaagaaact      3300
     tatgataaaa taaaagaatt taaagatatg ttttttttaa aactattttt ttttacatta      3360
     tatttatttt ttatatcata taattcagca aatatattat ggaatgtgat caaaatattt      3420
     atgttctttt tacaatttga ggaaaatcat tctcttctac ttttctattt ttatcgatgt      3480
     tatacacatc ttaattattt aataaagaaa aaaaatgatg tatacaattt ggatacatgt      3540
     attttattaa aaaatatatt atctttatta ttaaatacga aaaaagaaaa ttataaaacc      3600
     tttaattttt acaattattt tattaataca atacatatcc aagaaaatga taacaaacat      3660
     ttggatttaa accaaccttt taaatatgat gattcttttt tcttttttaa tagcatagta      3720
     ttatctaaag aacaatcggg aactataaat aaaaaaaaaa ataaaaatat taagaatata      3780
     aaagatgata tggataataa tacatcatac aatatgccga atatacaaaa agtaacaaaa      3840
     aaaaatatac aaaccaatat aacaaatgaa ctttatattt taataaataa acatgaacaa      3900
     tataaacaaa aatggattaa cacatttcct ttttatataa tttatcaaaa tgatcatttt      3960
     aaattatatt taaaacatct aaaagataat aaacaattaa ttttatatat acacctaaaa      4020
     aatgatacct ttatacttaa taatttcaat ttatatacat catttaattt aataaattat      4080
     aatatattag ataaatataa tcctgattat accaatttta atgatgatgt ggaaaattat      4140
     ttttataaat ataataacat caccattcaa aagatggatg attataatca tcctattaat      4200
     aacaaaaatg ttatacaaat aaaaaatata actaggtcta tttttatatc tataaaatat      4260
     gatacatata tctcagatat aaaattctgt tatgactatt tttttaatac tcaaaatgtg      4320
     caaaataaag ggttacttat aataccttat gtaaaaatgg atcctctcca tttatcgacg      4380
     gaagacttta aaagggttaa tagtaaaaac gtaatgttaa gaaatgtgaa ctacgaaata      4440
     accaccgaga aaaatagcaa tatttataaa ctactgttca attatttttt atttttatca      4500
     caatatttga atatatcttt ttttaacatg aataacattt ttgttaattt aaaaaatgaa      4560
     gtacaaatga atgaattaag aattattttt tgtatatgcg aaagtacgaa aaagagtatg      4620
     agcactttag aagataacat tgtcttatta ttaaatgtga aacctcagaa aaaagaagaa      4680
     agtaatattt cttataatta taatatttat ataaaaatga aaattttaaa taattcacag      4740
     gatgatagta acaagcttct tgattatttc gagttttata tcaaacaatt atttttacaa      4800
     aaaataataa atattgactt ttcattctga                                       4830
//

If you have problems or comments...

PBIL Back to PBIL home page