(data stored in SCRATCH zone)

EMBL: AL844507.PE79

AL844507.PE79        Location/Qualifiers
FT   CDS_pept        join(421493..421506,421791..421865,422013..422640)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808300"
FT                   /product="ubiquitin regulatory protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0808300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.122:mRNA"
FT                   /db_xref="GOA:Q8IAS1"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR012989"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036241"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAS1"
FT                   /protein_id="CAD51289.1"
FT                   /translation="MSNIRSLSDLKKDDKKNNERVAHYTGGQKSGLEVQNSDDDFVQNL
FT                   FKSKLPENCRHITLYKNGFIVDDGEFRDLEIEENKKFMANIEAGILPKEFASKDKTMNV
FT                   AIKDKSNQIYTKKKTKEQELYKGQGVKLGGTISSISEEEMNKISTDPNNIKEIKIDDKK
FT                   PITTLHIRLYNGKKITQKFNYDHTVEDLFQFVFSYTPVNFSLSYDYPLKLINRNEHQTL
FT                   ESAKLLDLLITQKLIP"
     atgtcaaata taagatcact aagtgattta aagaaggatg ataaaaaaaa taatgaacga        60
     gtggcccatt ataccggagg tcaaaagagc ggactagagg tacaaaattc agatgatgat       120
     tttgttcaga atcttttcaa atccaaattg ccagaaaact gtaggcacat tacattatac       180
     aaaaatggtt ttatagtaga tgatggtgaa tttcgtgacc ttgagataga agaaaataaa       240
     aagtttatgg caaatatcga ggcagggata ttaccaaaag aatttgcttc aaaagataaa       300
     acaatgaatg tagctataaa agataagagt aatcaaatat atacaaagaa aaaaacaaaa       360
     gaacaagaat tatataaagg tcaaggtgtt aaattaggtg gtactatctc aagtattagt       420
     gaagaagaaa tgaataaaat ttcaacagat ccaaataata taaaagaaat aaaaattgat       480
     gataaaaaac caataactac attacatata agattatata acggaaaaaa aattacgcaa       540
     aaatttaatt atgatcatac agttgaagat ttatttcaat tcgtttttag ttatacacca       600
     gttaattttt cgttatcata tgattaccct cttaaattaa ttaacagaaa tgaacatcaa       660
     accttggaaa gtgcaaaatt gttggatctt cttataacac aaaaattaat cccataa          717
//

If you have problems or comments...

PBIL Back to PBIL home page