(data stored in ACNUC9543 zone)

EMBL: AL844507.PE81

AL844507.PE81        Location/Qualifiers
FT   CDS_pept        complement(join(424794..424937,425043..425171))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808450"
FT                   /product="protein MPODD, putative"
FT                   /protein_id="VWP74353.1"
FT                   /translation="MIKLPFYSFNKNSLLVQCLKSACVYYIPQNLLVLSAFIFYKYKKS
FT                   QFTNGKRIPITNCNEAIHNFVVEKKLKKDDIQIQKKKNVYIISLV"
     atgattaaat taccttttta tagttttaat aaaaattcct tacttgtaca atgtttgaaa        60
     tcagcatgtg tatattacat ccctcagaat ttattggttc ttagtgcttt tattttttat       120
     aaatataaga aaagtcaatt tactaatggc aaaaggattc ctataacaaa ctgcaatgaa       180
     gcaatacata attttgtggt tgaaaaaaaa ttaaaaaaag atgacataca aatacagaaa       240
     aaaaaaaatg tatacatcat atcgttagtt tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page