(data stored in SCRATCH zone)

EMBL: AL844507.PE82

AL844507.PE82        Location/Qualifiers
FT   CDS_pept        join(431165..436546,437636..439051)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808600"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0808600"
FT                   /db_xref="GOA:Q8IAS3"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAS3"
FT                   /protein_id="CAD51287.1"
FT                   /translation="MPPLGRQVGGSPQDDDAKNMFDRIGKDVYDQVKKGVAETYKEALT
FT                   GQLSLATLLGVESASTTDPCGLDYSKLISGSGVAARGHPCGNESVSEKRFSKERVDEYD
FT                   EKKIKDNKGNRGNNEGECAPYRRLSLCNKNFQKINNIDSDKARHNLLVDVCLAAHYEGD
FT                   SIKAHLEQYDATYPGSGSTTCTALARSFADIGDIVRGRDLYRGNKKKIKTETERDKLEQ
FT                   KLKEIFKNIKKENNEKLKSLTDDQIREYWWTANRHTVWKAITCKADASSAYFHATCSDS
FT                   HRSGTFSQANNYCRCNGDQPGNDKENIDPPTYFDYVPQYLRWFEEWAEDFCRKKKHKLN
FT                   DAIQKCRGEDKYGKDRYCDLNGYDCEKTKRGRNMYRWDHKCTGCFLSCSHFRTWIDNQK
FT                   LEFLKQKEKYTNEISGGKSRKKRAARSSSSSSYDNGYEKKFYDQLKAGGYNGVNSFLDL
FT                   LSKEKTCKDITDTEGGKIDFKNVNSDKNSYDDDSNKTFSHTEYCQACPLCGVKRNGRKW
FT                   ERKEVMKDCPPINLYKPKKDAEGTLINFLYSGDETNEIAKKLKAFCAQANGDTTNGTGG
FT                   NGTGGSVAGGTGTSGSNELYQKWKCYEIDELTKDQKEGGEDDPVYDEDVKTGGGLCILE
FT                   NKNKSKGSQSNSQKEPDEIQKTFNPFFYYWVVHMLKDSIHWRTKKLDKCINNSNESKAC
FT                   KNNNKCKDDCGCFLKWVVQKKTEWENIKKHFKKQKDIPPGFTHDDVLEGVLEKEVLLTS
FT                   IKEGYGNEKDIKHIKKLLDEEEAAGVTDNENKTTIDKLLKHEKDEADKCKQIQEECNKQ
FT                   KQQERGGPGGRSADPSPPADLDEHSSDEGEEDDDDDEEEENANEETAEDATEDTQVDGT
FT                   EVVEETVAEVTEVTEVKPCEIVQKLFTNGDLQNTFKDACEQKYGYPQRHWGWKCISDTT
FT                   TGKSGDNTGSSGAICIPPRRRKLYIGKIKEWANSGNTQAAEPQEDGKAQTPQGQTPSQS
FT                   GKESSQSQKLREAFIQSAAIETFFLWDRYKKVKNKEIAEKKQRDSTNPFGFTQSTSGGM
FT                   QALPVGGAVQGAQAQLPDGAGGSDQTPEKQLAGGKIPEVFLRQMFYTLGDYRDICVGNT
FT                   PSGIDTNDKENMQKIQNKIKSVIEKSDSTPRTPGTHSPSSGTTPQALWDKISPSIWEGM
FT                   LCALTYKDGGEGKKIEKVNDANGDDLFQKLKDKYSDYKTVTLEEDNTSSAMSTSPRTSE
FT                   TTSASSDNTPTLNNPKLSDFVLRPPYFRYLEEWGQNFCKKRTEMLEKIKEECRSGTGGH
FT                   EYCSGDGHDCTDNDRKYNKMIADFHCPGCAKECMKYKTWIGKKFEEFKKQENTYKVEHG
FT                   KLTNNNCSGSDNTKFCQQIKNNSFDKFLELLRHCKDGKDDTDKDNELNFSKPLQTFSRS
FT                   TYCKACPIYGVKYNRGTYSAINESEYMSKNGISGENKNDKKPTEIKVLLLGRKGEVRNN
FT                   DEELKELKEVCNNAGFVEDYSLQKWNCQKKNGVDQCNLTNSVDNIDDSDKIIPFNVFFQ
FT                   RWLRNFVHDYNKLKQKIHPCIKNEDGKEHKCIEGCKKKCECVEKWLDKKSTEWDEIKKH
FT                   YEKHSKDHNEGIPHSVKGYLVQAPFKDEVLKAIKPCDFDNFKTSCGLNGTDNSQNGNNN
FT                   DLVLCMIKNLEKKIEQCKKKHDENKKTPCDPLPPLPDENDETLEENPVAQPNICPQLPE
FT                   EPKETCEEAVTPSEPKKAEEEPAAEPEAVPEEEAPLPPPPPAAPPRESKEKAKPPPKPR
FT                   IKTRHVLDHPAVIPALMSSTIMWSIGIGFAAFTYFFLKKKTKSSVGNLFQILQIPKSNY
FT                   DIPTKRSPNRYIPYTSGKYRGKRYIYLEGDSGTDSGYTDHYSDITSSSESEYEEMDIND
FT                   IYAPRAPKYKTLIEVVLEPSGNNTTASGKNTPSDTQNDIPTSDTPPPITDDEWNTLKHD
FT                   FISQYLPNTQNTEPNILHDNLDNNTHPTPSRHTLDQKPFIMSIHDRDLYSGEEISYNIH
FT                   MSTNSMDDPKYVSNNVYSGIDLINDTLSGNKHIDIYDEVLKRKENELFGTNYKKNTSNN
FT                   SVTKNINSDPIDNQLNLFHTWLDRHRDMCEQWNNKEELLDKLKEEWENETHSGNKHSDI
FT                   PSGKLSDTPSDNNIHSDIHPSDIPSGKQSDIPSDNNIHSDIPYVLNTDVSIQIHMDNPK
FT                   TTNEFTYVDSNPNQVDDTYVDSNPDNSSMDTILDDLEKYNEPYYDVQDDIYYDVNDHDT
FT                   STVDSNAMDIPSKVQIEMDVNTKLVKEKYPIGDVWDI"
     atgccgcctc taggtcgtca ggttggtggt agtccacagg atgatgatgc caaaaatatg        60
     tttgatagga tagggaaaga cgtgtacgac caagtgaaaa agggtgttgc tgaaacatat       120
     aaagaggcgt tgacaggaca gttgtcacta gcaacacttt tgggtgtgga atcagctagc       180
     accacagatc catgcggact tgattatagt aaacttatta gtggtagtgg tgttgctgct       240
     cgcggtcatc cgtgcggaaa tgaaagtgta agtgaaaaac gtttttctaa agaacgtgtc       300
     gatgaatatg atgagaaaaa aataaaagat aataaaggta atagaggtaa taatgaagga       360
     gagtgcgctc catatagaag gttatctcta tgtaacaaaa attttcaaaa aatcaataat       420
     attgatagtg ataaagctag acataattta ttggtagatg tgtgtcttgc agcacactat       480
     gaaggggact caataaaagc acatcttgaa caatatgatg caacatatcc tggttctggt       540
     tctacaacat gtactgcact tgcacgaagt tttgcagata taggtgatat cgttagagga       600
     agagatctgt atcgtggtaa taaaaaaaaa attaaaacag aaacagaaag agataaatta       660
     gaacagaaat tgaaagaaat tttcaagaac attaagaaag agaataatga aaaacttaaa       720
     tcccttacag atgaccaaat tagggaatat tggtggactg cgaatcggca caccgtgtgg       780
     aaagccatca catgtaaggc ggacgcaagt agtgcatatt ttcatgcaac gtgcagtgat       840
     agtcatcgta gtggaacttt ttctcaagct aataactact gccggtgtaa cggcgaccag       900
     ccaggtaacg acaaggaaaa tatcgatccc ccaacctatt tcgattatgt gcctcaatat       960
     ttgaggtggt tcgaggaatg ggcagaagac ttttgtcgta aaaaaaaaca caaattgaac      1020
     gatgcgatac aaaaatgtcg tggagaagat aaatatggta aggatcgata ttgtgatctt      1080
     aatggatatg attgcgaaaa aaccaaaaga ggaagaaaca tgtatcgttg ggatcacaaa      1140
     tgtactggct gtttcctttc ttgctctcat tttagaacat ggatagataa ccaaaaacta      1200
     gaatttctaa aacaaaaaga aaaatataca aatgaaatat caggtggtaa aagcaggaaa      1260
     aaacgagctg cacgtagtag tagtagtagt agttatgata atggatatga aaaaaaattt      1320
     tatgaccaac tgaaagcagg tggctataat ggtgttaata gttttttgga tttattaagt      1380
     aaagaaaaaa catgcaaaga tattactgac acagaaggag gaaaaattga tttcaaaaac      1440
     gtaaatagtg ataaaaatag ctatgacgat gatagtaata aaacattttc tcatacagaa      1500
     tattgtcaag catgtcctct atgtggggtc aaacgtaatg gtaggaaatg ggaaaggaaa      1560
     gaggttatga aggattgtcc gcctataaac ctttataagc ctaaaaagga cgcagaaggt      1620
     actcttatta atttcctgta cagtggtgat gaaactaatg aaattgcaaa aaagctaaaa      1680
     gcgttttgcg ctcaagcaaa tggtgataca acaaatggta ctggtggtaa tggtactggt      1740
     ggtagtgttg ctggaggtac tggcactagt ggtagtaacg aattgtatca aaaatggaaa      1800
     tgttatgaaa ttgacgagct gacgaaagat caaaaagaag ggggtgagga tgacccagtg      1860
     tatgacgagg atgtaaaaac tggaggcgga ttatgtatat tggaaaacaa aaataaaagc      1920
     aaaggaagtc aaagcaattc tcaaaaggaa cctgatgaaa tccaaaagac attcaatcct      1980
     tttttttact attgggtggt acatatgtta aaagattcca tacactggag aacaaaaaaa      2040
     cttgataagt gtataaataa cagtaatgaa tcaaaagcat gtaaaaacaa taataaatgt      2100
     aaggatgatt gtggttgttt tttaaaatgg gttgtacaaa aaaaaaccga atgggaaaat      2160
     ataaaaaaac attttaaaaa gcaaaaagat attccaccgg gatttactca cgatgatgtt      2220
     cttgaaggtg ttttggagaa agaggtactt ttgacaagta ttaaagaggg ttatgggaat      2280
     gaaaaggaca taaaacacat taagaaactg ttggatgagg aagaagcagc tggtgtaacc      2340
     gacaatgaaa ataagaccac aattgataaa ttactaaaac acgaaaaaga cgaagcagat      2400
     aaatgcaaac aaattcaaga agaatgcaat aaacaaaaac aacaagaacg aggtggccct      2460
     ggaggtcgtt ccgccgaccc ctcaccacct gctgacctcg acgaacactc ctcagacgaa      2520
     ggtgaagaag acgacgacga cgacgaagaa gaggaaaacg ccaacgagga aaccgcagag      2580
     gacgccacag aagacacaca agtggatggg acagaggtcg tagaagaaac cgtcgcagag      2640
     gtaacagagg taacagaggt gaagccatgt gaaatagtac aaaaactatt tactaatggc      2700
     gacctacaaa acacttttaa agatgcgtgt gaacaaaaat atggttaccc acaacgacat      2760
     tgggggtgga aatgtataag tgatacaacc actggcaaaa gtggtgataa caccggtagt      2820
     agtggtgcta tatgtattcc cccgagacgt cgcaaactat atataggtaa aataaaggag      2880
     tgggcaaaca gtggtaacac acaggcggca gaaccacagg aggatggtaa ggcacagaca      2940
     ccacaaggtc aaacaccatc acaaagtggt aaagagtcgt cacaaagtca gaaattgcgt      3000
     gaggcgttca tccaatctgc tgcaatagaa acttttttcc tatgggatag atataaaaag      3060
     gttaaaaata aggaaatagc tgaaaaaaaa caacgagata gtacaaaccc atttggcttc      3120
     acccagtcaa catcaggtgg aatgcaagca ttaccagttg gaggagcagt acagggagca      3180
     caagcacaac tacccgatgg tgccggtggt agtgaccaaa ctcccgaaaa acaattggct      3240
     ggtggcaaaa tacctgaggt tttcttacgt cagatgtttt atacgttagg ggattataga      3300
     gatatatgtg tggggaacac acctagtggt atagatacaa atgataaaga aaatatgcaa      3360
     aaaatacaaa ataaaataaa aagtgttatt gaaaaaagtg attccacacc tcgcacacct      3420
     ggtacccact ccccatctag tggtacaacc cctcaagcct tgtgggataa aatctcccct      3480
     tctatttggg aaggaatgtt atgtgcttta acatacaaag atggcggaga gggcaaaaaa      3540
     atagaaaagg ttaacgatgc gaacggcgac gaccttttcc aaaaactgaa agacaaatac      3600
     agcgactaca agacagtcac actcgaagaa gataatacct cctccgccat gtctaccagt      3660
     cccagaacct ccgaaaccac ctcagcctct agtgataaca cccccaccct caacaacccc      3720
     aaattgagtg atttcgtgtt acgccccccc tacttccgat accttgaaga atggggtcaa      3780
     aatttttgta aaaaacgaac agagatgttg gagaagataa aggaggaatg tcgcagtggc      3840
     acaggaggtc atgaatattg tagtggggat ggacatgatt gtacggataa tgatcgtaaa      3900
     tataataaaa tgattgcaga ttttcattgt ccaggttgtg caaaagaatg tatgaaatat      3960
     aaaacatgga taggaaaaaa attcgaagaa tttaagaagc aagaaaatac atataaagtg      4020
     gaacatggta aattaacgaa taataattgt agtggtagtg ataatacaaa attttgtcaa      4080
     caaataaaaa ataattcttt tgataaattt ttggaattat tgagacattg caaagatggt      4140
     aaggatgata cggataaaga taatgaatta aattttagta agcctctcca aaccttttct      4200
     cgttcaacgt attgtaaagc gtgtcctata tatggagtta agtataatag gggaacatat      4260
     agcgctatta atgaaagtga atatatgagc aaaaatggta ttagtggaga aaataagaac      4320
     gataagaaac ctacggaaat taaagtactt ctgttaggtc ggaaaggaga agttaggaat      4380
     aatgatgaag aacttaaaga acttaaagaa gtttgtaata atgccggttt tgttgaggat      4440
     tatagtcttc aaaaatggaa ctgccaaaaa aagaatggag tggatcagtg taatcttaca      4500
     aattctgtgg ataatataga tgatagtgat aaaattattc cgtttaatgt tttttttcag      4560
     cgttggttaa gaaattttgt acacgattat aataaattga aacagaaaat tcatccatgt      4620
     ataaaaaatg aagatggaaa ggaacataaa tgtattgaag gatgtaaaaa aaaatgtgaa      4680
     tgtgtagaaa aatggttaga taaaaaatct acagaatggg atgaaataaa aaaacattat      4740
     gagaaacatt caaaagatca taatgaaggt attcctcata gtgttaaagg ttatcttgta      4800
     caggcaccgt ttaaggatga agttctcaaa gctataaaac cttgtgattt tgataacttc      4860
     aagacttcgt gtggtcttaa tggcactgat aattcacaaa atggtaataa taacgatctt      4920
     gttttatgta tgattaaaaa ccttgaaaaa aaaattgaac aatgcaaaaa gaaacacgac      4980
     gaaaacaaaa aaacaccgtg tgatccatta ccccctctac ctgacgaaaa cgatgaaacc      5040
     cttgaagaaa acccagtggc gcaaccgaac atttgtccgc aactaccaga ggaaccaaaa      5100
     gagacttgtg aagaagcagt cactcctagt gaaccaaaaa aagcggaaga agaaccagca      5160
     gcagaacccg aagccgtgcc cgaagaagaa gcaccgttac ctccacctcc ccctgcggcc      5220
     ccacctcgtg agagcaaaga aaaagcaaaa ccccccccaa aacctcgaat caaaacccgt      5280
     catgtattgg accaccccgc tgtcataccc gccctcatgt cttctaccat catgtggagt      5340
     attggcatcg gttttgctgc gttcacttat ttttttctaa agaaaaaaac caaatcatct      5400
     gttggaaatt tatttcaaat actgcaaata cccaaaagta attatgatat accgacaaaa      5460
     cgttcaccca atagatatat accttatact agtggtaaat acagaggcaa acggtacatt      5520
     taccttgaag gagatagtgg aacagatagt ggttacaccg atcattatag tgatattact      5580
     tcatcttccg aaagtgaata tgaagagatg gatatcaatg atatatatgc accacgtgct      5640
     cctaaatata aaacgttgat agaagtggta cttgaaccta gtggtaacaa cacaacagct      5700
     agtggtaaaa acacacctag tgatacacaa aatgatatac caactagtga tacaccacca      5760
     cccattactg atgatgagtg gaatacattg aaacatgatt ttatatctca atatttacca      5820
     aatacacaaa atacggaacc aaatatttta catgataatt tggataataa tacccatccc      5880
     accccgtcac gtcatacgtt ggaccaaaaa ccttttatta tgtctattca tgatagggat      5940
     ttatatagtg gagaagaaat tagttataat attcatatga gtactaatag tatggatgat      6000
     ccaaaatatg tatcaaataa tgtatattct ggtatcgatt taattaatga cacattaagt      6060
     ggtaacaaac atattgatat atatgatgaa gttttgaaaa gaaaagaaaa cgaattattt      6120
     ggaacaaatt ataagaaaaa tacatcaaac aatagtgtta cgaaaaatat taatagtgat      6180
     cctatagata atcagttgaa tttgtttcat acatggttag atagacatag agatatgtgt      6240
     gaacaatgga ataataaaga ggaactatta gataaattga aagaagagtg ggaaaatgag      6300
     acacatagtg gtaacaaaca tagtgacata cctagtggta aactaagtga tacacctagt      6360
     gataacaaca tacatagtga tattcatcct agtgatatac ctagtggtaa acaaagtgat      6420
     atacctagtg ataacaacat acatagtgac ataccatacg tgttaaatac tgatgtttcc      6480
     atacaaatac atatggataa tcccaaaact acaaatgagt ttacatatgt ggatagtaac      6540
     cccaaccaag tggatgacac ctacgtggat agtaaccctg acaattcttc catggatact      6600
     atcttggacg atctggaaaa atataatgaa ccttattatg atgtacaaga tgatatttat      6660
     tatgatgtaa atgatcatga tacatcaact gtggatagta atgctatgga tatacctagc      6720
     aaagtacaaa ttgaaatgga tgtaaatacc aaattggtga aagagaaata tcctatagga      6780
     gatgtgtggg atatataa                                                    6798
//

If you have problems or comments...

PBIL Back to PBIL home page