(data stored in ACNUC9543 zone)

EMBL: AL844507.PE83

AL844507.PE83        Location/Qualifiers
FT   CDS_pept        join(440408..445771,446731..448062)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808700"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0808700"
FT                   /db_xref="GOA:Q8IAS4"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAS4"
FT                   /protein_id="CAD51286.1"
FT                   /translation="MAASTTYSSAPDAKHLLDMIGKDVHDQVKKEAKERSKGELTGQLS
FT                   FASILGERAYTTDPCQLIKEKRENLIGDRGERHPCGNGSGKGEDVNRFSKERVDEYDNK
FT                   KMKCSYGSNGKSEGACAPFRRLHVCDKNIQQIKTENITTHNLLLDVCLAAKYEGESLKG
FT                   YHEQYEVQYPSSGSTMCTELARSFADIGDIVRGRDLYGGSKKEKEKRKQLDDKLKKIFE
FT                   NIKKENNEKLKSLTDDQIREYWWTANRETVWKAITCDEENKLGGYLYFRGTCGDNEKSV
FT                   TQARDKCRCKKKDNTPDDQVPTYFDYVPQYLRWFEEWGEDFCRKKKKKVENAKKKCRGE
FT                   NNDKYCSRNGCDCEKTVRAKGKLRYGNRCTDCLYACYPYVHWIDKKKEEFDKQVKKYDE
FT                   EIKKYTKVASGSSRKTRAATIKYEGYEKKFYEKLKESDYGKVDKFLEKLSKDKECEKVD
FT                   DEEGGKINFAEKHDNNNNDEKEGTFYRSKYCQPCPYCGMKKKVPGKEWEKKNDNCTSGK
FT                   LYEPKGDAEGTPIKILKSGENHDDIKQKIDDFCKTEDDESLYAAWKCYKHDEVQKVKRE
FT                   GEEEDDDEEDYKNVKAAGGLCILENQKKKEEGKEKKSEKEPEQFQKTFNDFFTYWVAHM
FT                   LKDSIYWRTKKIKKCLENGKTMKCRNGCNNDCDCFESWVKQKKEKEWKPIKDHFGKQED
FT                   IKQETGMDPGDFLEYYLKLQFFEEVSEEKSQTGDEDANEKKRIKEMFDKKNQRTDKVAS
FT                   NEETIIDFMLEEELKDATKCKQDCEQRKPPGAGGGDVRSDTVPSRDPLTPGPTDGHEDS
FT                   EDEEEEEEEEDEEHGPDDKEGTEENVEETETVEDQVEEEKAKDNTDGKGEEEEDNQGET
FT                   TQITTQDGVNPCDIVDKLFKDDNTLTNACPTKYEKGREKFPNWKCIPSGDKTDTRERAG
FT                   RSRRDTSGENTTTGSSGDTNGSVCVPSRRRKLYIQKLHDWAEKQVGTTQVDGKAAQGDA
FT                   ASKDPKVELRNAFIQSAAVETFFLWHKYKAENTKTQGGVGSLPLQTIDRNSANGDDEDN
FT                   PEKQLKEGTIPHGFLRQMFYTLGDYRDILVGKYVDNGKDMEEVKSNIDSFFSNGEKPDD
FT                   KKGVEQRKEWWKENAKHIWHGMICALTYDTNTASGDKHTLKQNKSLKEALWDEQKKKPK
FT                   KTDNGSDYTYESVVLKEDDEGGGPRGQTSSPSSGEKTTLNNPKLSDFVLRPPYFRYLEE
FT                   WGQNFCKERKKRLEKIEEECMEYGSRGKQKQKYSGDGEECEKVLVEDANIFSDLSSSCA
FT                   TPCRKYRKWIERKKYEFTEQYNAYGGQKNNYVNEQKDKCQTQSNNHDNGFCGTLEKDAA
FT                   AFLNRLKNGPCKNNNDNGEEHKIDFNDTKKTFKHTEYCGPCSEFKVKCKNGACGDSNTQ
FT                   KKCNGITPIDGNEIAKMITSTEEVVMRVSDNSGNRFDGDLKEACNGKGIFKSIKENKWE
FT                   CRNVCGYVVCKPKEGNRETASGENKDQIITIRALVTHWVQNFLDDYKKIKHKISQCTKT
FT                   DQGSTCQNKCQNKCKCVGEWIPKKREEWEKIRKRFLEQYKIENDEDFNVRSCLENFLVQ
FT                   IGAANAKNKVIKLSKFGNSCGCSADASAQKNDGHKDAIDCLLQKLQNKIDDCNKNQAQN
FT                   SVETQPSDENPAQCQDTHPDDDLLLEEEQNPKNMRPGFCPEDDTTEQQEEEQDTCTPAG
FT                   TVKEEEEEKEEKKDKGDEEEESPSGNSAPDPPESPSAGPNHNQHPPAIPTPATPAADPP
FT                   QADEPFNRDILEKTIPFGVALALGSIAFLFLKKKTKSSVGNLFQILQIPKSDYDIPTLK
FT                   SKNRYIPYKSGPYKGKTYIYMEGDSDEDKYAFMSDTTDITSSESEYEEMDINDIYVPGS
FT                   PKYKTLIEVVLEPSGNNTTASGKNTPSDTQNDIQNDGIPSSKITDNEWNTLKHDFISNM
FT                   LQNEPNTEPNILHDNLDNNTHPTMSRDNMEEKPFITSIHDRNLYTGEEYNYNVNMVNSM
FT                   DDTKYVSNNVYSGIDLINDTLSGNKHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKLT
FT                   NSDPIHKQLDLLHTWLDRHRHMCEKWNNKEELLDKLKKEWNKENNTNSSLTHTSNIPSG
FT                   ENSIKNVLNTDVSIQIDMDNPKPKNEFTNMDTIPDKSTMDTILDDLEKYNEPYYYDFYK
FT                   DDIYYDVNDDDKTSMDDIYVDHNNVTSNNMDVPTKMHIEMNIVNNKNEIFEEEYPISDI
FT                   WNI"
     atggcagcat ccactacgta tagtagtgcc ccggatgcca agcatctttt ggatatgatt        60
     gggaaagacg tgcatgacca agtgaaaaag gaagctaaag aacgtagtaa gggtgaattg       120
     acaggacagt tgtcatttgc atcaattttg ggggaaagag catacaccac agatccgtgc       180
     caacttataa aagaaaaacg tgagaacctt attggtgatc gcggtgaaag gcatccgtgc       240
     ggaaatggaa gtggaaaagg agaagatgta aaccggtttt ctaaagaacg tgtcgatgaa       300
     tatgataaca aaaaaatgaa atgtagttat ggtagtaatg gtaaaagtga aggtgcatgt       360
     gctcctttca gacgattaca tgtatgtgat aaaaatatcc aacagataaa aactgaaaat       420
     ataacaacac ataatttatt attagatgtg tgtcttgcag caaagtatga aggagagtcc       480
     ttaaaaggtt atcatgagca atatgaagta caatatcctt cttctggttc tacaatgtgt       540
     actgagttgg cacgaagttt tgcagatata ggagatattg tcagaggaag agatttgtat       600
     ggaggtagta aaaaagaaaa agaaaaaaga aaacaattag atgataagtt gaaaaaaatt       660
     ttcgaaaaca ttaagaaaga gaataatgaa aaacttaaat cccttacaga tgaccaaatt       720
     agggaatatt ggtggactgc aaatcgagaa acagtatgga aagctattac ttgtgacgaa       780
     gagaacaagc tagggggtta tttatatttt cgaggaacat gtggtgataa tgaaaaaagt       840
     gtaactcagg ctagagacaa atgccgctgt aagaagaaag acaacacccc cgacgaccag       900
     gtccccacat atttcgatta tgtgccacag tatcttcgct ggttcgagga atggggtgaa       960
     gacttttgcc gtaaaaaaaa aaaaaaagta gaaaatgcta aaaaaaaatg tcgtggagaa      1020
     aataatgaca aatattgtag ccgtaatggc tgcgattgcg aaaaaacagt tagagcaaaa      1080
     ggtaagttac gttatggtaa tagatgcact gactgtttgt atgcatgtta tccttacgtt      1140
     cattggatag ataagaaaaa agaagaattt gacaaacaag taaaaaaata tgatgaagaa      1200
     ataaaaaaat atacaaaggt agcatcaggt agtagtagga aaacgcgagc tgcaactatc      1260
     aagtatgaag gatatgaaaa aaaattttat gaaaaactga aagaaagtga ctatggaaaa      1320
     gttgataaat ttttggaaaa attaagtaaa gataaagaat gtgaaaaagt tgacgacgaa      1380
     gaaggaggaa aaattaattt tgctgaaaaa catgataata ataataatga tgaaaaagaa      1440
     ggaacatttt atcgttcaaa atattgccaa ccatgtcctt attgtggaat gaaaaagaaa      1500
     gttcctggta aggaatggga aaagaaaaat gataattgca cgagtggaaa actttatgag      1560
     cctaaaggtg acgcagaagg tactcctatt aaaatcctta aaagtggtga aaatcatgat      1620
     gatataaaac aaaaaattga cgacttttgc aaaacagaag atgatgaatc tttatatgca      1680
     gcatggaaat gttataaaca tgacgaggta cagaaagtga agcgtgaggg tgaggaagag      1740
     gatgatgacg aggaggatta taaaaatgta aaagctgcag gcggattatg tatattggaa      1800
     aaccaaaaaa aaaaagaaga aggaaaagaa aaaaagtctg aaaaggaacc tgagcaattc      1860
     caaaagacat tcaatgattt ttttacatat tgggttgcac atatgttgaa ggattccata      1920
     tattggagaa caaagaaaat taagaaatgt ttagaaaatg gtaagacaat gaaatgtaga      1980
     aatggatgta ataatgattg tgactgtttt gaaagctggg ttaaacaaaa aaaagaaaag      2040
     gaatggaagc caataaaaga ccattttggc aagcaagaag atattaaaca ggaaacagga      2100
     atggatcctg gcgattttct tgaatactat ttgaaattac aattttttga agaagtttcc      2160
     gaagaaaaat cccaaactgg tgacgaggat gcaaatgaaa aaaaacgcat taaggaaatg      2220
     ttcgacaaga aaaaccaacg gacagataag gttgcttcca atgaggaaac aataattgat      2280
     ttcatgctcg aagaggaact aaaagacgcc accaaatgca aacaagactg tgaacaacga      2340
     aaaccacccg gcgctggagg tggtgacgtc cgctccgaca ccgtcccctc acgcgacccc      2400
     ctcacacctg gccccactga cggccacgag gactccgaag acgaagaaga agaagaggag      2460
     gaggaagatg aagaacacgg ccccgacgac aaggagggta ccgaggaaaa cgtcgaggag      2520
     acggagacgg tggaagacca ggtggaagag gaaaaggcaa aggacaacac ggacgggaag      2580
     ggggaggagg aagaggacaa ccagggggag accacacaga taacaacaca agacggggtg      2640
     aatccatgtg acatagtgga caaactattt aaagacgaca atactcttac aaatgcctgt      2700
     ccaaccaagt atgaaaaggg ccgagaaaaa ttccccaatt ggaaatgtat accaagtggt      2760
     gacaaaacag acactcgtga acgtgctggc cgttccagac gtgacactag tggtgagaat      2820
     actaccactg gtagtagtgg tgacactaat ggtagtgttt gtgtgccatc caggaggcga      2880
     aaactataca tacaaaaact acacgattgg gcggaaaaac aggtgggtac cacacaggta      2940
     gatggtaagg cagcacaagg tgacgccgcg tcgaaagacc ccaaagtgga actacgaaat      3000
     gcttttatcc agtctgcggc agttgaaact tttttcttat ggcataagta taaagcggaa      3060
     aatacgaaga cacaaggtgg tgttggatca ctaccactac aaaccatcga ccgaaacagt      3120
     gcaaacggcg acgacgaaga caaccccgaa aaacagttaa aagaaggaac aatacctcat      3180
     ggtttcttgc gacagatgtt ttatacacta ggggattata gagatatatt agttgggaaa      3240
     tatgtggata atggtaagga tatggaggaa gtaaaaagta atatagatag ctttttttca      3300
     aatggtgaaa aacctgatga caaaaagggt gtcgaacaac gtaaagaatg gtggaaagaa      3360
     aacgcaaaac acatttggca tggaatgata tgtgccttaa cctatgacac aaacacagcg      3420
     agtggcgata aacacacatt aaaacagaat aagagtttga aagaggcact ttgggacgaa      3480
     cagaaaaaaa aacccaaaaa aaccgacaat ggcagcgact atacatatga aagtgtggta      3540
     cttaaagaag atgatgaagg tggtggcccc agaggccaaa cctcctcacc ctctagtggt      3600
     gaaaaaacca ccctcaacaa ccccaaattg agtgatttcg tgttgcgacc cccctacttc      3660
     cgttaccttg aagaatgggg tcaaaatttt tgtaaagaga ggaaaaaaag attggagaag      3720
     atagaggagg agtgtatgga atatggaagt cgtggtaaac aaaaacaaaa atatagtggg      3780
     gatggggaag aatgtgaaaa ggttctcgtt gaggatgcaa atattttttc agatttaagt      3840
     tcgagttgtg caacaccttg tagaaaatat aggaaatgga tagaaagaaa aaaatacgaa      3900
     tttactgaac aatataatgc atatggtgga caaaaaaaca attacgtaaa tgaacaaaaa      3960
     gacaaatgcc aaacacaaag taataatcat gataatggat tttgtggaac actagaaaag      4020
     gacgctgcag catttttaaa taggttaaaa aacggaccat gtaaaaataa taatgataat      4080
     ggagaagagc ataaaataga ttttaatgat acaaagaaaa catttaaaca tacagaatat      4140
     tgtggtccat gttctgaatt taaagttaaa tgtaaaaatg gtgcttgcgg tgatagtaat      4200
     acgcaaaaga aatgcaatgg aataacgcct attgatggaa atgaaattgc aaaaatgata      4260
     acttctactg aagaagttgt tatgcgtgtc agtgataata gtggaaatag atttgatggt      4320
     gatttaaagg aggcttgtaa cggtaaaggt atttttaaaa gtattaaaga aaataaatgg      4380
     gaatgtcgta atgtatgtgg ttatgttgta tgtaaaccga aagaaggaaa tagggaaaca      4440
     gccagtgggg aaaacaaaga tcaaattata acaattagag ctttggttac acattgggta      4500
     caaaattttt tagacgatta taagaaaatt aaacataaaa tttcacagtg tacgaaaact      4560
     gatcaaggat ccacatgtca aaataaatgt caaaataaat gtaaatgtgt tggagaatgg      4620
     atacctaaga agagggaaga atgggaaaaa ataagaaagc gtttccttga acaatataaa      4680
     attgaaaacg atgaagattt taacgttaga agttgtttgg agaacttctt agttcaaatt      4740
     ggtgctgcaa acgctaaaaa taaggttata aaattaagta agttcggtaa ttcttgtgga      4800
     tgtagtgccg atgcgagcgc acaaaaaaac gatggtcata aggatgctat agattgtttg      4860
     cttcaaaagc ttcaaaataa aattgacgac tgcaataaga accaggccca aaatagtgtc      4920
     gaaacccaac cgagtgatga aaacccagca cagtgtcaag atacccaccc tgatgatgac      4980
     ttactccttg aagaagaaca aaacccaaaa aatatgcgac cgggattttg tccggaagac      5040
     gatacaacag aacaacaaga ggaagaacaa gacacttgta caccagcagg aactgttaaa      5100
     gaagaagaag aagaaaaaga agagaaaaaa gataaaggag atgaagaaga agaatcacct      5160
     agtggtaatt ctgccccaga tccaccagaa tcacctagtg cgggacccaa ccacaaccaa      5220
     caccccccag cgattccaac cccggcaaca ccagcagcag atccccctca agcggacgaa      5280
     ccattcaatc gtgacattct ggaaaagacc attccttttg gagtggcgtt ggcattagga      5340
     tccattgctt ttttattttt gaagaaaaaa accaaatcat ctgttggaaa tttattccaa      5400
     atactgcaaa tacccaaaag tgattatgat atacctaccc ttaaatccaa aaataggtac      5460
     ataccatata aaagtggtcc atataaaggc aaaacatata tatatatgga aggagattca      5520
     gacgaagata aatatgcatt tatgtctgat actactgata taacctcgtc agaaagtgaa      5580
     tatgaagaaa tggatatcaa tgatatatat gtaccaggta gtcctaaata taaaacattg      5640
     atagaagtgg tactagaacc tagtggtaac aacacaacag ctagtggtaa aaacacacct      5700
     agtgatacac aaaatgatat acaaaatgat ggtataccta gtagtaaaat tacagataat      5760
     gagtggaata cattgaaaca tgattttata tctaatatgt tacaaaatga accaaataca      5820
     gaaccaaata ttttacatga taatttggat aataataccc atcctaccat gtcacgtgat      5880
     aatatggaag aaaaaccttt tattacttct attcatgata gaaatttata tactggagaa      5940
     gaatataatt ataatgttaa tatggttaat agtatggatg acacaaaata tgtatcaaat      6000
     aatgtatatt ctggtataga tttgattaat gacacattaa gtggtaacaa acatattgat      6060
     atatatgatg aagtattgaa acgaaaagaa aacgaattat ttggaacaaa tcatgtgaaa      6120
     caaacaagta tacatagtgt tgccaaacta acaaatagtg atcccatcca caaacaatta      6180
     gatttgttac atacatggtt agatagacat agacatatgt gcgagaagtg gaataataaa      6240
     gaggaattat tagataaatt aaaaaaagag tggaataaag aaaataacac taatagtagt      6300
     ctcacacaca ctagtaacat accaagtggt gaaaatagta ttaagaatgt gttgaatact      6360
     gatgtttcta ttcaaataga tatggataat cctaaaccaa agaatgaatt tacgaatatg      6420
     gatacaatcc ccgacaaatc tactatggat actatattgg atgatctaga aaaatataac      6480
     gaaccctact actatgattt ttataaagat gatatctatt atgatgtaaa tgatgatgat      6540
     aaaacatcta tggatgatat atatgtggat cataataatg taactagtaa taatatggat      6600
     gtacctacta aaatgcacat cgaaatgaat attgttaata ataaaaatga gattttcgaa      6660
     gaggaatatc ctatatcaga tatatggaat atctaa                                6696
//

If you have problems or comments...

PBIL Back to PBIL home page