(data stored in SCRATCH zone)

EMBL: AL844507.PE88

AL844507.PE88        Location/Qualifiers
FT   CDS_pept        complement(474788..474991)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809250"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /protein_id="VWP74360.1"
FT                   /translation="MSVLCHTLFSFFKDLRSLYKPYTAFSFFFFPCAINMYGIIKFNNS
FT                   DYHINKSVTDANAYMKRTAQEK"
     atgtcagttt tatgtcacac cttgtttagt ttttttaagg accttaggag tttatacaaa        60
     ccatatacag cattttcttt ctttttcttc ccatgtgcta taaatatgta tggaattata       120
     aaatttaata attcagatta ccatataaat aaaagcgtaa cagatgccaa tgcatatatg       180
     aaaaggactg cccaagaaaa ataa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page