(data stored in ACNUC9543 zone)

EMBL: AL844507.PE89

AL844507.PE89        Location/Qualifiers
FT   CDS_pept        475573..478125
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809400"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0809400"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0101:mRNA"
FT                   /db_xref="GOA:Q8IAS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAS9"
FT                   /protein_id="CAD51281.1"
FT                   /translation="MRVTNKFSLISLECLQVNLLIPFYKKKTKRIDNHFFLFKRFNSFD
FT                   KIHSLDKNCNNLSFEYKNNINHIDDKNELNHNFIGKKTNFLNKQTSENKKKVLQNKNDD
FT                   KYKDFHSANENDDDKFSNNFFFCDDTHEFKNNQINEISTDNTYEYTNDEYNEDIDDDLD
FT                   TLLLTNNLNSSLIGELWHASANSIYKNNKKLDIHDEKKNKNQINHIDETSTNIIKQIDN
FT                   CVHTNINVPQTHDKQKCKENFSNSFVNEIYEKEEKETQKMKEYLEQHEEHFSTFRNSIL
FT                   CKLRIAEELSRNTNHSSKENINKYNKNKEEYYKNLIDSINNTNNPIINVNNNHYHNKKK
FT                   KKNYNYYPVNNNINYDHVETIKILDIDNIPCNILNNLFAYNIVKNCSAELCLKIISRLG
FT                   MYRDKYSQISYENMINYLGQVLNCSKNAEIIALFSRCYETISIPFLVNYVRKYGTFSRA
FT                   FIVNMYDKYFKKRLFDFVRYENNMGIRKIPNILTHPYHLSSYTKLLGECSAKKDMYVQL
FT                   KIRGHIPDTFQITEENKSEEEIDYLMNAKKDSNKKIDNVNNIDLIENSTQKNKKRSSKI
FT                   IERPKMYDIILSSEYTGLPIEHFIDKQKKIEDDKHSKDVMKTLPDKEIIIGYDILQNDF
FT                   ILNDELDKENKQKIIINKKQNGDILNVNNNNNNNKESIQSTYNMNKLNIQENQENEQNI
FT                   HFNNNENTNFILDDDCDIYVYKRFNKLNNSSFKMQTTLVKTETNEEKNQNNEIDLYINK
FT                   GQYFEEIDMEQNNKSLWKLPWNSIKKDSFYFKGRFFKIIPNEGWSEIKELSKNYIKPKR
FT                   RRTKHCIKRQRILQKKIKVNLFKKKILENYDKMKKTKK"
     atgcgtgtta caaataaatt ttccctcata agtttggaat gtttacaggt gaatttatta        60
     attccttttt ataagaaaaa aacgaaaaga atagataatc atttttttct atttaaaagg       120
     tttaattcat ttgataaaat acattcactg gacaaaaact gtaataattt atcatttgaa       180
     tataaaaata atattaacca tattgatgat aaaaatgaat tgaatcataa ttttatagga       240
     aaaaaaacaa actttttaaa taagcaaaca agtgaaaaca agaagaaagt attacaaaat       300
     aaaaatgatg ataaatacaa agatttccat tctgcaaatg aaaatgacga tgataagttt       360
     agtaataatt tttttttttg tgatgacaca catgaattta aaaacaatca aattaatgaa       420
     atttcgactg ataacacata tgaatataca aatgatgaat ataatgaaga tatagatgac       480
     gatttagata ccttattatt aacaaacaac ttaaactcaa gtttaatagg agaactttgg       540
     catgcatcag caaatagtat ttataaaaat aataaaaagt tagatattca cgatgaaaaa       600
     aaaaataaaa accaaataaa tcatattgat gaaacatcta caaatattat taaacaaata       660
     gataattgtg tacacacaaa tataaatgta ccacaaacac atgataaaca aaagtgtaag       720
     gaaaattttt caaattcatt tgttaatgaa atatatgaaa aagaagaaaa agaaacgcaa       780
     aaaatgaaag aatatttaga acaacatgaa gaacattttt caacgtttag aaattcaatt       840
     ttatgtaaat taagaatagc tgaagaatta tctcgaaata ctaatcactc aagtaaagaa       900
     aatataaata aatacaataa aaacaaagaa gaatattata aaaacttaat agattctata       960
     aataatacaa ataacccaat aattaatgta aataataatc attatcataa taaaaaaaaa      1020
     aaaaaaaatt ataattatta tccagtcaat aataatatta attatgatca tgtggaaacc      1080
     atcaaaattt tagatattga taatattcca tgtaatatat taaataattt atttgcatat      1140
     aatattgtaa aaaattgtag tgcagaattg tgtttaaaaa taataagtag attaggtatg      1200
     tatagagata aatattctca aatatcttat gaaaatatga ttaattattt aggtcaagta      1260
     ttaaattgtt caaaaaatgc agaaattatt gcactttttt ctagatgtta tgaaactata      1320
     agtattccct tcttagttaa ttatgttagg aaatatggta cattctctag agcttttata      1380
     gttaatatgt atgataaata ttttaaaaag agattatttg attttgtaag atatgaaaat      1440
     aatatgggaa ttcgaaaaat accaaatata ttaactcatc cgtatcattt atcatcatat      1500
     acgaaattat taggggaatg ctccgctaaa aaagatatgt atgtacagct aaaaatacga      1560
     ggtcatattc cagatacttt tcaaataaca gaagaaaata aaagtgaaga ggaaattgat      1620
     tatttaatga atgctaaaaa ggattctaat aaaaaaattg ataatgtcaa taatatagat      1680
     ctaatagaaa attcaacaca aaaaaacaag aaaagatcta gtaaaattat cgaaagaccg      1740
     aaaatgtatg acatcatttt atcatcagaa tatacaggtc tacccattga acattttata      1800
     gataaacaaa aaaagataga agatgacaaa catagtaagg atgtaatgaa aacattacca      1860
     gataaggaga taataattgg atatgatata ttacaaaatg attttatatt aaatgatgaa      1920
     ttagataagg aaaataaaca aaaaattata ataaataaga aacagaatgg tgatatatta      1980
     aatgttaata ataataataa taataataaa gagtctatac aaagtacata taacatgaac      2040
     aagttaaata ttcaagagaa ccaagaaaat gaacagaata ttcattttaa taataatgaa      2100
     aataccaatt ttattcttga tgatgattgt gatatatatg tatataaacg atttaacaaa      2160
     ttaaacaact catcatttaa aatgcaaact actttggtaa aaacagaaac aaatgaagaa      2220
     aaaaaccaaa ataatgaaat agatctctat attaataaag gacaatattt tgaagaaata      2280
     gatatggaac aaaataataa atctttatgg aaattacctt ggaatagtat aaaaaaagat      2340
     tccttttatt ttaaaggtag attttttaaa attataccta atgaaggatg gtccgaaatt      2400
     aaggaactat ccaaaaatta tattaagcca aaaagaagaa gaacaaaaca ttgtattaaa      2460
     agacaaagaa ttttacaaaa aaaaattaaa gttaatttgt ttaaaaaaaa aattttagaa      2520
     aattatgata aaatgaaaaa aacaaaaaaa tga                                   2553
//

If you have problems or comments...

PBIL Back to PBIL home page