(data stored in ACNUC9543 zone)

EMBL: AL844507.PE90

AL844507.PE90        Location/Qualifiers
FT   CDS_pept        complement(478512..478826)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809500"
FT                   /product="histone acetyltransferase subunit NuA4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0809500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.114:mRNA"
FT                   /db_xref="GOA:C0H4T2"
FT                   /db_xref="InterPro:IPR015418"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4T2"
FT                   /protein_id="CAX64108.1"
FT                   /translation="MKHKVKRDIMKCKKKLESSIKALEEKILRLELEYHKNCNVNGGNL
FT                   IKGWESHLRKTPLEPLSFRTFRDDYGDSYVERMLSLTSCTSPATALFPSEDTIREKRKM
FT                   "
     atgaaacata aggttaaacg tgatataatg aaatgtaaaa aaaagctgga aagttctata        60
     aaagcattag aagaaaaaat tttaagactt gaattagaat atcataagaa ttgtaatgtt       120
     aatggaggga atttaataaa aggttgggaa agtcatttaa gaaaaacacc attagaacct       180
     ttgagtttca ggacatttag agatgactat ggagattcat atgtagaaag aatgttatca       240
     ttaacatctt gtacatctcc tgccacagct ttatttccaa gtgaagatac aataagagaa       300
     aaacgtaaaa tgtaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page