(data stored in ACNUC9543 zone)

EMBL: AL844507.PE93

AL844507.PE93        Location/Qualifiers
FT   CDS_pept        complement(join(502338..502408,502526..502611,
FT                   502758..503021,503226..506698))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809800"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0809800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.112:mRNA"
FT                   /db_xref="GOA:C0H4T4"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4T4"
FT                   /protein_id="CAX64110.1"
FT                   /translation="MDVNKNESKGQNYKKKNSDIIFYTPKSNLAIDSLQKTIAFNNLFK
FT                   YVNKNIKKDEIKNDEIKNYEINNDEIKNYEINNDEIKNYEINNDEIKNYEINNDDIKSY
FT                   EINNDKIKRYEINNDKIKRYEINNDKIKRYEINNDKIKRYEINNDKIKRYEINNDKIKC
FT                   DKIKNDHLKNVPVKKKKKEYTKNMIGRKVHTDELHKENIFVLPKDNINNKFGEKKKIPL
FT                   KQKNKKVKKRTFSESTINILSYFKNDKIIKLKEKDNEKYTEKYRKTGTPHIDINNSIKS
FT                   NINSTKFNNVNIINPLITNIDNLNIVYRKVNEKSYLDVNSCHKRIRSEHYQSKIFLEEK
FT                   IKLNNIDYKNNTCNEVDDNLNHFKKYIHGNDVKQNENYLYDKNIKINDYPIHNKDEILI
FT                   EKEKYYEYLENVYLYSKKYFLSDKMEYISKYLFYKNKNLKNFIFLIDSLFLKKKYVEIL
FT                   ELLRNYRHLWIFPIHMKNKFKVKNFDKKEKINNIDTKNMTNKKHGNKQKNKNTQLFIHQ
FT                   NNIIYNDDKIINNNKKNNNNKIINNNINNNNNNNIYTDDYYNSLYKKEQNLKLFRKNIE
FT                   CEHFNRNKNIIFNNMKLYDPQNIPIQNTNDYIPKKINEKRKKKKKKNRKCSCIYVNNMC
FT                   ESYYPFIYNKKKSTKRMYYCISYIAFVKLICLLKLKNSNCLNKGIRFVSRIYKKMFLNK
FT                   NTHYFIHAIIRLYELKGLFNSSLKYSMILFLNFPLYPHIILKLFSFSILCLREEMYLIL
FT                   LASYPKHFAWFKYFLFFILYSINFQFRDKKVFDSFLFLIENVNKKKKKKKLKRKQKGKD
FT                   IIYEMEKDDFSIFDENICIDINNNKRNIENNKNNIENNKNNNENNKNNIENNKNNIENN
FT                   KNDINNINMINNNNYYYIYNLQNNICEKKEIYNNVSNDLYDLNKPMLSHDNINSNMFIY
FT                   KKIILYKSSYNKVTLYDTYNYLVNNKFSKYFPKFFIYSKLYIIINIKKSFYEKNFIMCY
FT                   SLCKLLLNDYIYDPCVITFFVNSCYLLNNVSSIKRLASDLKKNNMYIYFLFCNATLLLH
FT                   FREIDKSIQIYKYIVDTYENVFSDLYFFSFLNLINTLHITQKASQIINHCICFNKLFFN
FT                   NIQTYLLLSYHYYINNIPLKSYSSIMKAYKIYHYNPDVFYMLSLLSLTDKRYKEYVTFS
FT                   ELSLFFSLRLSIIRNYIFSKIYETQYEYLPFHLLYYNFKIVNFENSVIKFPMNMEPFMC
FT                   HLFFENLIKSYVTYHIYSSERQGLDYLLLAENLCKIGFIFFSKDLKFLQMLKFIQGYKL
FT                   KNTRMCYSIDNIS"
     atggatgtaa ataaaaatga atctaaagga caaaactata aaaagaaaaa ctctgatatt        60
     attttctaca cacccaaatc aaatttggcg attgacagtt tacaaaaaac tattgccttt       120
     aataatttat ttaaatatgt taataaaaat attaaaaaag atgaaataaa aaatgatgaa       180
     ataaaaaatt acgaaataaa taatgatgaa ataaaaaatt acgaaataaa taatgatgaa       240
     ataaaaaatt acgaaataaa taatgatgaa ataaaaaatt acgaaataaa taatgatgac       300
     ataaaaagtt atgaaattaa taatgataaa ataaaaagat atgaaattaa taatgataaa       360
     ataaaaagat atgaaattaa taatgataaa ataaaaagat atgaaattaa taatgataaa       420
     ataaaaagat atgaaattaa taatgataaa ataaaaagat atgaaattaa taatgataaa       480
     attaagtgtg ataaaataaa aaatgatcat cttaaaaatg taccagtaaa aaaaaaaaaa       540
     aaagaatata cgaaaaatat gatagggaga aaagtgcata cagacgaatt gcataaggaa       600
     aatatttttg ttctacctaa ggataatatt aataataaat ttggagagaa aaaaaaaatt       660
     cccttaaaac aaaaaaataa aaaagtaaaa aaaagaacct tttctgaaag tactataaat       720
     attttatcat attttaaaaa tgacaaaata ataaaattaa aggaaaaaga taatgagaaa       780
     tatacagaaa agtatagaaa aacaggtaca ccacatatcg atattaataa ttcgataaaa       840
     tcgaatataa acagtaccaa atttaataat gttaatatta ttaatccatt aattacaaat       900
     attgataatc ttaatatagt atatagaaaa gtaaatgaaa aatcgtattt ggatgtaaat       960
     agttgtcata aaaggattag aagtgaacat tatcaatcaa aaattttcct tgaagaaaaa      1020
     attaaattaa ataatattga ttataaaaat aatacatgta atgaagttga tgacaattta      1080
     aatcatttta aaaaatatat tcatggtaat gacgtaaagc agaatgaaaa ttatttatat      1140
     gataaaaata taaaaattaa tgattatcct atacataata aagatgaaat acttatagaa      1200
     aaagaaaaat attatgagta tttggaaaat gtttacctat attctaagaa atatttctta      1260
     tccgataaaa tggaatatat tagtaaatac ttattttaca aaaataagaa tttaaaaaat      1320
     ttcatttttt taattgattc attattttta aaaaaaaaat acgtggaaat tttggaatta      1380
     ttgagaaatt atcgacattt gtggattttt ccaattcata tgaaaaataa gtttaaagtc      1440
     aaaaattttg ataaaaagga gaaaataaat aatatagaca cgaaaaatat gactaataag      1500
     aagcatggga ataaacaaaa aaataagaat acacagttgt ttatccatca gaataatatt      1560
     atttataatg atgataaaat aattaataat aataaaaaaa ataataataa taaaataata      1620
     aataataaca taaataataa taataataat aatatttata cggatgatta ttataatagt      1680
     ttatataaga aagaacagaa tttaaaattg tttcgaaaaa atatcgaatg tgaacatttt      1740
     aatagaaata aaaatattat ttttaacaat atgaaattat atgacccgca aaatatacca      1800
     attcaaaata caaatgatta tatacctaaa aaaataaatg aaaagagaaa aaaaaaaaaa      1860
     aaaaaaaata gaaaatgttc ttgcatttat gtaaataata tgtgtgaaag ttattatcca      1920
     tttatttata ataaaaaaaa aagtacaaag agaatgtatt attgtattag ttatatagcc      1980
     tttgtaaaat taatttgtct ccttaaacta aaaaatagta attgtttaaa taaaggtata      2040
     cgttttgtaa gtagaatata taaaaaaatg tttttaaata agaatactca ttattttatc      2100
     catgcaatta taaggttgta tgaattaaaa ggattattta attcgtccct taaatattca      2160
     atgatactat ttttgaattt tccattatat cctcatatta ttcttaaatt atttagtttt      2220
     tccatattgt gtttgaggga agagatgtat ttaatcttat tagctagtta tcctaagcat      2280
     tttgcttggt tcaaatattt cctctttttc attttatatt ctatcaattt tcagtttaga      2340
     gataaaaagg tttttgatag tttccttttc ttaattgaaa atgtaaataa aaagaagaaa      2400
     aagaaaaagt tgaaaagaaa acaaaaagga aaagatataa tttatgaaat ggaaaaagat      2460
     gatttctcta tatttgatga aaacatttgt atagatataa ataataataa aagaaatatt      2520
     gagaataaca aaaacaatat tgagaataac aaaaacaata atgagaataa caaaaacaat      2580
     attgagaata acaaaaacaa tattgagaat aacaaaaacg atattaataa tattaatatg      2640
     attaataata ataattatta ttatatttat aacttacaaa ataatatatg tgaaaaaaaa      2700
     gaaatttata acaatgtatc taatgattta tacgatttaa acaaacccat gttatctcat      2760
     gataatataa atagtaacat gtttatatat aaaaagatta tattatataa gtcatcatat      2820
     aataaagtaa ctttatatga tacatacaac tatcttgtta ataataaatt ttccaaatat      2880
     tttccaaaat tttttatcta ttccaaattg tatattataa taaatattaa aaaaagtttt      2940
     tatgaaaaga attttatcat gtgttatagt ttatgtaaat tgttattaaa tgattatata      3000
     tatgatcctt gtgtgattac tttttttgtt aattcttgtt atttattaaa taatgttagc      3060
     tctataaaaa ggttagctag tgatttaaaa aaaaataata tgtatatata ttttttattt      3120
     tgtaatgcaa cattattatt acattttcga gaaatagata aatcgattca aatatataaa      3180
     tatattgtcg atacttatga aaatgtattt tctgatttat attttttttc tttcttaaat      3240
     ttaataaata cattacatat aactcagaag gcatctcaaa ttattaatca ttgtatatgt      3300
     tttaataagt tgttttttaa taatatacaa acatatttat tattatctta tcattattat      3360
     ataaataata taccactcaa atcgtattcg tctataatga aagcttacaa aatatatcat      3420
     tacaaccccg acgtttttta tatgctatct ttgttatcct taacagataa aaggtataaa      3480
     gaatatgtaa catttagtga actatcactt ttttttagtt taagattaag tataattaga      3540
     aattatatct tttctaaaat atatgaaaca caatatgagt atttaccgtt tcatttatta      3600
     tattacaatt ttaaaattgt gaatttcgag aattctgtga ttaaatttcc tatgaacatg      3660
     gaacctttta tgtgtcactt attttttgaa aatttaataa aatcatacgt tacttatcat      3720
     atatattcat ctgaaaggca aggtctcgat tatctcctgt tggctgaaaa tttgtgtaaa      3780
     attggtttta tttttttttc aaaagattta aaatttttac aaatgctaaa atttattcaa      3840
     ggttataaat taaaaaatac aagaatgtgt tattccattg ataatataag ttaa            3894
//

If you have problems or comments...

PBIL Back to PBIL home page