(data stored in SCRATCH zone)

EMBL: AL844507.PE94

AL844507.PE94        Location/Qualifiers
FT   CDS_pept        complement(join(508224..508574,508688..508763,
FT                   508944..509022,509155..512428))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809900"
FT                   /product="JmjC domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0809900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.111:mRNA"
FT                   /db_xref="GOA:Q8IAT4"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR004198"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAT4"
FT                   /protein_id="CAD51276.1"
FT                   /translation="MDKQITGIKKRKRNREFVLSCDDDDDVNYIDTGKKTNGCINKVDK
FT                   KLLNQKDLYQIKKVYDTRNKSFLKNNEINYKNIEEDNYTYIENIFDEEEFEEWKNGKKK
FT                   NDDSEQANDVFDDPIRGNINDMTNDITNDMTNDMTNDMTNDITNDMTNDITNDITNDIS
FT                   NDITNEDELIDISNNKYKKSIYKRGIDDTNMNSKKSVSMCSEYKGKCVVNNELNNIQNE
FT                   HNNVNNFERVLGNLPQRQHMSNISNGNNNNDNDNNNNNNNIINNKNNNNNINNNNNNNN
FT                   CRNNNCSNNSDDENIYKRIKEIPEINTTMEEMTNPMLFFEKYNYMGLKYGALKVIPPSF
FT                   FSPQFNSYYLNIKFNIRRQMINELKNGKEFDHPDEYWTLYEMYKYNEMLQNKYLSSDNK
FT                   FDLDNIEKTYWDIINNKKNEDVISVYGADLPVKRNQPTCIFPNKYKSNISMTKNTSNGI
FT                   IKSGTNKIKRKNTSNKINENNKNEEPINNNKKKNKKNKKHNNIYNNSVQNNIDEIVIDS
FT                   DEDEHVKSVKKIACCPKKIKENQTKASYTISKEKVLQKDTNEIIEVINILDTDNEEDHG
FT                   DNKIESHVIKSNGNNIKQNKNNTNYYNIKECDNNNNNNNMHNDKRCDHNINNTVVCKKN
FT                   DNVRKDYNFLERKNNYFCEINDIISNISENMNIKSLPFIRGSMLRNIDILIEGVNIPWL
FT                   YIGTLFSTFCWHTEDNYFASINYQHWGQPKIWYVIPPHYSDKVEDVIYEYLKENSKINI
FT                   NNNKGGTSYMGGGRRRRGKYFRKRRFSMPLHNRNNRKSSNDITNEMNVKNNSTNIDIDI
FT                   NSNSNTNNNNNNNNNNNHNYYNNRNNSLNLYNRNNNEKDYIYFEADKNNKYNFLNVNIN
FT                   DVDLIYTDPYLKYKNVDKDEIDSKKENNKNKIYKLTIQIPVEVFLKNNIPVYKNIQRKN
FT                   EFIFLWPKTFHGGFNSGYNCNEACNIAPTFWLFFGLQSYYNYKYYRNTCISIHFILFSN
FT                   LLHFHEYSFSQLKHIIYSLRYILLDEHRFFCENQSMYIDLNLQHDVLLNKKIVNYSNFV
FT                   SLDLVKIFYNFEKHKNSHFFQSVKSKLQFFYKDCDACNSPTFNSAVICPHSNDIVCIHC
FT                   YDEHACNCKYRVVLKRYTLLEMMKVLKLLIHYANKIRKSDEKEINFDDMPNYNSMKFFE
FT                   EQNSFKLFNLIRQNKKRNTPTLYADLENYCAKKLMNIEKFKRPNHNQNNNIILDDYYTS
FT                   VSHFKTKLTLKYFFLTYEEEKEENSMQILPKIVS"
     atggataagc aaattactgg tataaaaaag aggaaaagaa atcgagagtt tgtattatca        60
     tgtgatgatg atgatgatgt taattatata gatacaggga aaaagaccaa tggctgtata       120
     aataaagtcg ataagaaatt attgaatcaa aaggatttat atcaaataaa gaaagtatat       180
     gatacaagaa ataagtcttt tttaaaaaat aatgaaataa attataaaaa tattgaagaa       240
     gacaattata catatataga aaatatattt gatgaagaag aatttgaaga atggaaaaat       300
     ggtaaaaaaa aaaatgacga cagtgaacag gcaaatgatg tatttgatga tcctataaga       360
     ggaaatataa atgatatgac aaatgatata acaaatgata tgacaaatga tatgacaaat       420
     gatatgacaa atgatataac aaatgatatg acaaatgata taacaaatga tataacaaat       480
     gacatatcga atgatataac gaatgaagat gaattaatag atatttcgaa taataaatat       540
     aagaaatcaa tatataaaag gggtatagac gatactaata tgaatagtaa aaaaagtgtg       600
     tctatgtgtt ctgaatataa aggaaaatgt gtagtaaata atgaattaaa taatatacaa       660
     aatgagcata ataatgtaaa taattttgaa agggtcctag gaaacctacc gcaaagacaa       720
     catatgagta acatttctaa tggtaataat aataatgata atgataataa taataataat       780
     aataatatta ttaataataa aaataacaat aataatatta ataataacaa taataataat       840
     aattgtcgta ataataattg ttctaataat tctgatgatg aaaatatata taaacgaatt       900
     aaagaaatac cagaaatcaa tacaactatg gaagaaatga caaatcccat gctgtttttt       960
     gaaaagtata attatatggg gttaaaatat ggagccttaa aagtaatacc tcctagtttt      1020
     ttttccccac aatttaattc ttattatctt aatattaaat ttaacataag aagacaaatg      1080
     attaatgaat tgaaaaatgg gaaggaattt gatcatccag atgaatattg gaccttatat      1140
     gaaatgtata aatataatga aatgctgcaa aataaatatt tatcatcaga taataaattt      1200
     gatttagaca atattgaaaa gacatattgg gatattatta acaataaaaa gaatgaagat      1260
     gtcatatctg tttatggtgc tgatttacct gtaaaaagaa atcaaccaac ttgtatattt      1320
     ccgaacaaat ataaatcaaa tatatccatg actaaaaata catcgaatgg tataataaaa      1380
     agtgggacaa ataaaataaa acggaaaaat acatcaaata aaattaatga aaataacaaa      1440
     aatgaagaac ctattaataa taataagaag aaaaataaaa aaaataaaaa acataataat      1500
     atatataaca attctgttca aaacaatatt gatgaaattg ttattgattc ggatgaagat      1560
     gaacatgtaa aatctgttaa aaaaattgca tgctgtccga agaaaataaa agaaaatcaa      1620
     acaaaagcta gctatactat aagcaaggaa aaagtacttc agaaagatac aaatgaaatt      1680
     attgaggtta taaatatatt agatacggat aatgaagagg atcatggtga taataaaata      1740
     gaaagtcatg taataaaatc taatgggaat aatataaagc aaaataaaaa taatacaaat      1800
     tattataata taaaagaatg cgataataat aataataata ataatatgca taatgataaa      1860
     aggtgtgacc ataatataaa taacactgtt gtttgcaaaa agaatgataa tgttagaaag      1920
     gattataact ttttagaacg aaaaaataat tatttttgtg aaattaatga tattattagt      1980
     aatatcagtg aaaacatgaa tataaagtca ttaccattta tacgaggttc tatgttaaga      2040
     aatatagata ttttaattga aggtgtaaat attccttggt tatatattgg aacattattt      2100
     tctacttttt gttggcatac cgaagataac tattttgctt ctattaatta tcagcattgg      2160
     ggtcaaccca aaatatggta tgttatacct cctcattata gtgacaaggt agaagatgta      2220
     atatatgaat atttaaaaga aaatagtaaa ataaatataa ataataataa aggtggaaca      2280
     tcatatatgg gtggaggtag acgaagaagg ggaaagtatt ttagaaagag gagattttcc      2340
     atgcccttac acaatagaaa caataggaaa tcatcaaatg atataacaaa tgaaatgaac      2400
     gtaaaaaata atagtacaaa tattgacatt gatattaata gtaatagtaa tactaataat      2460
     aataataata ataataataa taataaccat aattattata ataataggaa taattcttta      2520
     aatttatata atagaaataa taacgaaaaa gattatattt attttgaagc agataaaaat      2580
     aataaatata actttttaaa tgtaaacatt aatgatgtag atttaatata tactgatcca      2640
     tatttaaaat ataaaaatgt agataaagat gaaatagatt ccaagaaaga aaataataaa      2700
     aataaaatat ataaattaac aattcaaata cctgtagagg tatttttaaa aaataatatt      2760
     ccagtatata aaaatattca aagaaaaaat gaatttatat ttttatggcc aaagacattt      2820
     catggtggtt ttaattctgg ttataattgt aatgaagcat gtaatattgc accaaccttt      2880
     tggttatttt ttggacttca atcttattat aattataaat attatagaaa tacttgtata      2940
     tctattcatt ttatattatt ctcaaattta ttacatttcc atgaatattc tttcagtcaa      3000
     ttaaaacata tcatatattc attaagatat attttattag atgaacatcg atttttttgt      3060
     gaaaatcaat ccatgtatat agatttaaat cttcagcatg atgtactctt aaataaaaaa      3120
     attgttaatt attctaattt tgtctcatta gatctagtta aaatatttta caatttcgaa      3180
     aaacataaaa atagccattt ctttcaaagt gttaagagta aattacaatt cttttacaaa      3240
     gattgtgacg catgtaactc tcccacattc aacagtgcag ttatatgtcc acattcgaac      3300
     gatatcgttt gtatacactg ttatgatgaa catgcttgta actgtaaata tagggttgtt      3360
     ttaaagaggt ataccttatt ggagatgatg aaagttctca aacttcttat acattatgcc      3420
     aacaaaataa gaaaaagcga tgaaaaagaa ataaactttg atgatatgcc taattataat      3480
     agcatgaaat tcttcgaaga acaaaactcc ttcaagttat ttaatttgat tcgtcagaat      3540
     aaaaaaagga acacacctac actatatgcg gacttagaaa attattgtgc gaaaaaatta      3600
     atgaatatag agaaattcaa aagaccaaat cataatcaaa ataataatat tattctagac      3660
     gattattata catctgtaag tcattttaaa acaaaactta cattgaaata ttttttctta      3720
     acatatgaag aagaaaaaga ggaaaattct atgcaaatat taccaaaaat agtatcataa      3780
//

If you have problems or comments...

PBIL Back to PBIL home page