(data stored in SCRATCH zone)

EMBL: AL844507.PE95

AL844507.PE95        Location/Qualifiers
FT   CDS_pept        complement(517421..517693)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810000"
FT                   /product="acyl-CoA binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810000"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0099:mRNA"
FT                   /db_xref="GOA:Q8IAT5"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAT5"
FT                   /protein_id="CAD51275.1"
FT                   /translation="MRDSFNDCVQFVNKLPKTVNLSVDVKLDLYKYYKQSTVGNCNIEQ
FT                   PSMFKIEDRKKYNAWKSIENLEREEAQKRYIDIVTSLFPNWKDSE"
     atgagagatt catttaatga ttgtgttcaa tttgtaaaca aattaccaaa gacggtaaat        60
     ttatccgttg atgtaaaatt agacttatac aaatattata aacagagtac cgtaggtaat       120
     tgtaatatag aacaaccaag tatgtttaaa attgaggata ggaaaaaata caatgcatgg       180
     aaatccattg aaaacttgga aagagaagaa gcacaaaaaa gatatattga tattgtaaca       240
     tccttatttc caaattggaa agatagtgaa taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page