(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4936

AL939122.SCO4936     Location/Qualifiers
FT   CDS_pept        1593..2276
FT                   /transl_table=11
FT                   /gene="SCO4936"
FT                   /gene_synonym="SCK13.28"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="SCK13.28, possible ABC transporter ATP-binding
FT                   protein, len: 227 aa; similar to TR:Q9KRR8 (EMBL:AE004234)
FT                   Vibrio cholerae ABC transporter, ATP-binding protein
FT                   VC1568, 233 aa; fasta scores: opt: 746 z-score: 833.1 E():
FT                   0; 51.1% identity in 223 aa overlap. Contains Pfam match to
FT                   entry PF00005 ABC_tran, ABC transporter and matches to
FT                   Prosite entries PS00017 ATP/GTP-binding site motif A
FT                   (P-loop) and PS00211 ABC transporters family signature"
FT                   /db_xref="GOA:Q9ADK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK4"
FT                   /protein_id="CAC18704.3"
FT                   /translation="MYELSGVTKHYTRGKTTVHALDGVDLTIADGDRLVIQGPTGGGKS
FT                   TLLQMLGALDRPSSGRIVLDGTDLATLPEARLTRVRSESIGFVFQSFNLIPTLTAQENV
FT                   ETALVPLGVKAKERREQAAEALASVGLGERLGHLPGEMSGGQQQRVAIARALVKQPKVL
FT                   LADEPTGNLDESTRDEIMDVLDRMWKELGLTFVMVTHDSAIARKAPRVATIRKGRITVK
FT                   ENASA"
     atgtacgaac tcagcggcgt caccaagcac tacacccgcg gcaaaaccac cgtgcacgcc        60
     ctcgacggcg tcgacctgac catcgccgac ggcgaccggc tggtcatcca gggccccacc       120
     ggcggcggca agtccaccct gctccagatg ctgggcgccc tcgaccggcc cagctcgggc       180
     cggatcgtcc tcgacggcac cgacctcgcc acgctccccg aggccaggct gacccgggtg       240
     cgcagcgaga gcatcggctt cgtcttccag tccttcaacc tgatcccgac cctgaccgcc       300
     caggagaacg tcgagaccgc cctggtcccg ctcggcgtca aggcgaagga gcggcgcgag       360
     caggccgccg aggccctggc ctccgtcggc ctgggcgaac gcctcggcca cctccccggc       420
     gagatgtccg gcggccagca gcagcgcgtc gccatcgccc gcgccctggt gaagcagccg       480
     aaggtgctcc tcgccgacga acccaccgga aacctcgacg agtcgacccg cgacgagatc       540
     atggacgtgc tcgaccgcat gtggaaggag ctgggcctca ccttcgtcat ggtcacccac       600
     gactcggcga tcgccaggaa ggccccccgc gtggccacca tccgcaaggg ccgcatcacc       660
     gtcaaggaga acgcctcggc gtga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page