(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4937

AL939122.SCO4937     Location/Qualifiers
FT   CDS_pept        complement(2301..2819)
FT                   /transl_table=11
FT                   /gene="SCO4937"
FT                   /gene_synonym="SCK13.29c"
FT                   /product="hypothetical protein"
FT                   /note="SCK13.29c, hypothetical protein, len: 172 aa;
FT                   similar to TR:CAC04235 (EMBL:AL391515) Streptomyces
FT                   coelicolor conserved hypothetical protein SC4B10.30c, 156
FT                   aa; fasta scores: opt: 215 z-score: 274.7 E(): 9.2e-08;
FT                   30.9% identity in 139 aa overlap"
FT                   /db_xref="GOA:Q7ZAI8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ZAI8"
FT                   /protein_id="CAD30926.1"
FT                   /translation="MTTTTDTTTTAEQDGTRSRLPDPTGLYPELTALSAAVQKALRNGP
FT                   VPQATLALTRLRTAQVIGSTYHGVAATDALRKAGEEERRITAVATWQSAPCFTAPERAA
FT                   LELAEAVLTPNPFGDRVSDDLFARLSRHYDTDGIWHLTMALGHFSLFTPVALVGKPVPG
FT                   RPPGKNYTD"
     atgaccacca ccacggacac gaccaccacc gcggagcagg acgggacgcg gtcccgcctg        60
     cccgacccca ccgggctcta ccccgagttg acggccctct ccgctgccgt gcagaaggcc       120
     ctgcgcaacg gcccggtccc gcaggccacc ctcgctctga cgcgcctgcg caccgcacag       180
     gtgatcggca gcacctacca cggcgtcgcg gcgaccgacg ccctgcgcaa ggccggcgag       240
     gaggagcggc gcatcacggc cgtggcgacc tggcagagcg ccccctgctt caccgctccc       300
     gagcgggccg cgctggaact cgcggaggcc gtcctcaccc cgaacccgtt cggggaccgg       360
     gtgagtgacg acctgttcgc ccggctgtcc cggcactacg acaccgacgg gatctggcac       420
     ctcaccatgg ccctgggcca cttcagcctg ttcaccccgg tcgccctcgt cggcaagccg       480
     gtgcccggcc ggcccccggg taagaactac accgactga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page