(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4938

AL939122.SCO4938     Location/Qualifiers
FT   CDS_pept        3018..3932
FT                   /transl_table=11
FT                   /gene="SCO4938"
FT                   /gene_synonym="SCK13.30"
FT                   /product="putative ECF-sigma factor"
FT                   /note="SCK13.30, possible ECF-sigma factor, len: 304 aa;
FT                   similar to TR:Q9RJS2 (EMBL:AL132707) Streptomyces
FT                   coelicolor putative RNA polymerase sigma factor SCF51.13c,
FT                   298 aa; fasta scores: opt: 1110 z-score: 1299.2 E(): 0;
FT                   58.4% identity in 296 aa overlap. Contains Pfam match to
FT                   entry PF00776 Sigma70_ECF, Sigma-70 factor (ECF subfamily)
FT                   and possible helix-turn-helix motif at residues 144..165
FT                   (+2.59 SD)"
FT                   /db_xref="GOA:Q9EWW4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWW4"
FT                   /protein_id="CAD30927.1"
FT                   /translation="MTTRSAPVTGERRQLINVAYRMLGSLTDAEDAVQEAYARWYAMPA
FT                   DRREAVGSPGAWLTTVVSRVCLNHLRSARVRRELYVGQWLPEPLADPAERTAARTPGIA
FT                   SDPADLITLDESVGMAFLVVLDSMSPAQRVAFVLHDVFRYPFPEVARIVGRTPAACRRL
FT                   ASTARRGIRTAQESAATSTAQDAVVVRDLKRAWETNDVDALIRLLDPEVTAVGDGGGVV
FT                   RTLEHPLRGREPIVRGLLRFGPRQSGQTLLERTVNGRPGLVGCQDGTVVTVYSFGVSDH
FT                   RVRHLWAMRNPEKLRSWATAPAA"
     atgaccaccc gatccgcgcc ggtcaccggc gagcgacggc aactgatcaa cgtggcctac        60
     cggatgctcg gctcgctgac cgacgcggag gacgccgtcc aggaggcgta cgcccgctgg       120
     tacgcgatgc ccgcagaccg gcgggaggcc gtcgggtccc cgggggcctg gctcaccacg       180
     gtcgtcagcc gggtctgcct caaccacctg cgttccgccc gggtccggcg ggagctctac       240
     gtgggtcagt ggctccccga gccgctggcc gaccccgccg agcggaccgc cgcccgcaca       300
     cccggcatcg cctccgaccc ggccgacctg atcaccctcg acgagtcggt cggcatggcc       360
     ttcctggtcg tcctggactc gatgtccccc gcccagcggg tcgccttcgt tctccacgac       420
     gtcttccgct atccgtttcc cgaggtggcc aggatcgtcg gccgtacgcc ggccgcctgc       480
     cgccggctgg cgtccaccgc gcgccggggc atccgcaccg cacaggagtc cgccgccacg       540
     tcgacggcgc aggacgcggt cgtcgtacgc gatctcaagc gggcctggga gaccaacgac       600
     gtcgacgcgc tcatccgact cctcgacccc gaggtgaccg cggtcggcga cggcggcggt       660
     gtggtgcgca ccctggagca cccgctgcgg ggccgcgagc cgatcgtgcg cggactgctc       720
     cggttcggcc cgcggcagtc cgggcagacg ctgctcgaac gcacggtcaa cgggcggccc       780
     ggcctggtcg gctgtcagga cggcaccgtc gtgacggtgt actccttcgg cgtctcggac       840
     caccgcgtcc gccacctgtg ggcgatgcgc aaccccgaga agctgcgctc ctgggcgacg       900
     gccccggccg cgtga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page