(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4940

AL939122.SCO4940     Location/Qualifiers
FT   CDS_pept        4860..5462
FT                   /transl_table=11
FT                   /gene="SCO4940"
FT                   /gene_synonym="SCK13.32"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SCK13.32, possible tetR-family transcriptional
FT                   regulator, len: 200 aa; similar to TR:Q9KZX2
FT                   (EMBL:AL353815) Streptomyces coelicolor putative
FT                   transcriptional regulator SCD6.32c, 200 aa; fasta scores:
FT                   opt: 183 z-score: 230.1 E(): 2.8e-05; 28.3% identity in 159
FT                   aa overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 33..54 (+4.53 SD)"
FT                   /db_xref="GOA:Q8CJS4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:2HYJ"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CJS4"
FT                   /protein_id="CAD55220.1"
FT                   /translation="MSPRRSAAEAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMS
FT                   KSGVHKHFGTKETLQISTLDKAFVDFWHRVVEPALAEPPGLRRLRAVCANSVGYLEEPL
FT                   LPGGCLLTAALSEYDGRPGRVRDAVAEVWSRWREQLRADLTAAVDKGELPAGFDVEQAL
FT                   FEIVAAGLALNAAMQLQHDRTAADRARRAIERALAQS"
     atgtcaccac gacgttcagc tgccgaagcg caggccaccc ggggccggat cctcggccgt        60
     gccgccgaga tcgcctccga ggaagggctg gacggcatca ccatcggccg gctcgccgaa       120
     gagctggaga tgagcaagtc cggggtgcac aagcacttcg gcaccaagga gacgttgcag       180
     atctccaccc tggacaaggc cttcgtggac ttctggcacc gggtggtcga gccggccctg       240
     gccgagccgc cgggcctgcg gcggctgcgc gcggtgtgcg ccaactccgt gggctacctg       300
     gaagaacccc tgctgcccgg cggctgcctg ttgaccgcgg cactcagcga gtacgacggc       360
     cggcccggcc gggtccgcga cgcggtggcc gaggtgtggt cgcgctggcg ggagcagctg       420
     cgggcggacc tgaccgcggc ggtggacaag ggcgagctgc ccgccgggtt cgacgtcgag       480
     caggcgctgt tcgagatcgt cgcggccggg ctggcgctca acgcggccat gcagctccag       540
     cacgaccgca cggccgcgga ccgggcccgc cgcgcgatcg aacgggccct ggcccagtcc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page