(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4942

AL939122.SCO4942     Location/Qualifiers
FT   CDS_pept        complement(5964..6644)
FT                   /transl_table=11
FT                   /gene="SCO4942"
FT                   /gene_synonym="2SCK31.02c"
FT                   /product="putative regulatory protein"
FT                   /note="2SCK31.02c, possible regulatory protein, len: 226
FT                   aa; similar to TR:Q9KXX1 (EMBL:AL357432) Streptomyces
FT                   coelicolor putative transcriptional regulator SCD95A.03c,
FT                   199 aa; fasta scores: opt: 414 z-score: 464.7 E(): 2.4e-18;
FT                   38.2% identity in 204 aa overlap. Contains Pfam match to
FT                   entry PF00440 tetR, Bacterial regulatory proteins, tetR
FT                   family"
FT                   /db_xref="GOA:Q9EWE9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041467"
FT                   /db_xref="PDB:2PZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWE9"
FT                   /protein_id="CAD30929.1"
FT                   /translation="MVAYPGPMPRSPSPGQTPDAPTSGGGSTDSTRQRIVAAAKEEFAR
FT                   HGIAGARVDRIAKQARTSKERVYAYFRSKEALYAHVAERETTALIEATQLDPADLPGYA
FT                   GILFDHFAARPDHYRLITWGRLELAESADNTSGPLQATIAGKLDKLRDAQRIGLLDPAW
FT                   DPVDVLALINQIAMTWAGQPEIAAAAADQAVDPSVTARRAALVTAVEHMFPRPDRDQRP
FT                   NRLT"
     ttggtcgcct atcctggacc catgcctcgc tcccccagcc ctggtcagac cccggacgcc        60
     cccacctcgg ggggcgggtc caccgactcc acgcgccagc gcatcgtcgc cgcggccaag       120
     gaggagttcg cccggcacgg gatcgccggt gcccgcgtgg accgcatcgc caagcaggcc       180
     aggacgagca aggaacgtgt ctacgcctac ttccgcagca aggaagccct ttacgcgcac       240
     gtcgccgaac gcgagacgac cgcactcatc gaggcgactc agctggatcc ggccgacctg       300
     cccggttatg ccggcatcct cttcgaccac ttcgcggccc gtccggacca ctaccgcctg       360
     atcacgtggg gccgcctgga gctggccgag tccgcggaca acaccagcgg cccccttcag       420
     gccacgatcg ccggcaagct cgacaaactt cgcgacgcgc agcgcatcgg gctgctcgac       480
     ccggcctggg acccggtcga cgtcctcgcc ctgatcaacc agatcgccat gacctgggca       540
     ggtcagcccg aaatcgccgc cgctgccgcg gaccaggccg tggacccctc tgtcaccgcc       600
     cgccgcgccg cactggtgac cgccgtggag cacatgttcc ctcgcccgga ccgggaccaa       660
     cggcccaacc gtctgacgtg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page