(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4943

AL939122.SCO4943     Location/Qualifiers
FT   CDS_pept        6765..7757
FT                   /transl_table=11
FT                   /gene="SCO4943"
FT                   /gene_synonym="2SCK31.03"
FT                   /product="putative oxidoreductase"
FT                   /note="2SCK31.03, probable oxidoreductase, len: 330 aa;
FT                   similar to TR:AAG05923 (EMBL:AE004681) Pseudomonas
FT                   aeruginosa probable oxidoreductase PA2535, 331 aa; fasta
FT                   scores: opt: 1001 z-score: 1136.6 E(): 0; 48.2% identity in
FT                   328 aa overlap. Contains Pfam match to entry PF00248
FT                   aldo_ket_red, Aldo/keto reductase family"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWV3"
FT                   /protein_id="CAC21631.2"
FT                   /translation="MQHRTLGQQGLRVSALGLGVMGMSLAYGPSNDEDGISTIHRAHEL
FT                   GVDFFDTAELYGQGTGSNETLLGNAVNDFRDEVVLATKFGFDMTSKSLGSGVNSRPENI
FT                   REVAENSLRYLRTDRIDLFYQHISDPDVPAEEVAGTVGDLITEGKVRYFGLSNVGPRYI
FT                   RRAHAVTPVTALQYEYSIFEREVEDEILPVVRELGIGLVPYSPLGRGFLSGVVRPAGEY
FT                   PEDDMRRWDERWQGENYAYNLNAAEQLRKLAATKGITPAQLALAWLLAQGEDVVPIPGT
FT                   RSAARLEENVGAIDAELTEADLARIREVIPQGSAGSRYPASMMAGFRTD"
     atgcagcacc gcaccctggg gcaacaggga ctgcgcgtct ccgcgctcgg actgggcgtg        60
     atggggatgt ccctggccta cggtccctcg aacgacgagg acggcatctc caccattcac       120
     cgcgcccacg aactcggagt cgacttcttc gacaccgccg agctgtacgg ccaaggcacc       180
     ggcagcaacg agacgctgct cggcaacgcg gtcaacgact tccgcgacga ggtcgtcctg       240
     gccaccaagt tcggcttcga catgaccagc aagtcgttgg ggagcggcgt caacagccgc       300
     ccggagaaca tccgcgaggt cgctgagaac agcctgcgct acctccggac cgatcgcatc       360
     gacctcttct accagcacat ctccgacccc gacgtaccgg ccgaggaggt cgccggcacg       420
     gtgggtgacc tgatcaccga gggcaaggtg cggtacttcg gcctgagcaa cgtcggcccg       480
     cggtacatcc ggcgcgccca cgccgtcacc ccggtcacag cccttcagta cgagtactcg       540
     atcttcgagc gcgaggtgga ggacgagatc ctgccggtcg tgcgggagct ggggatcggc       600
     ctggtgccgt actcgccgct cggccgcggc ttcctctccg gtgtggtcag gccggccggc       660
     gagtatcccg aggacgacat gcgccgctgg gacgagcgct ggcagggcga gaactacgcc       720
     tacaacctga acgccgccga gcagctccga aagctcgccg ccaccaaggg catcaccccg       780
     gcgcagctcg ccctggcatg gctgctcgcc cagggcgagg acgtcgtccc gatcccgggc       840
     acccgcagcg ccgcacggct ggaggagaac gtcggcgcca tcgacgcgga actcaccgag       900
     gccgacctgg cccgtatccg ggaggtcatc ccccagggct ccgcaggcag ccgctacccg       960
     gcctcgatga tggccggctt ccgcaccgac tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page