(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4944

AL939122.SCO4944     Location/Qualifiers
FT   CDS_pept        complement(7855..8730)
FT                   /transl_table=11
FT                   /gene="SCO4944"
FT                   /gene_synonym="2SCK31.04c"
FT                   /product="putative DNA-binding protein"
FT                   /note="2SCK31.04c, possible DNA-binding protein, len: 314
FT                   aa; similar to TR:Q9RI67 (EMBL:AL109949) Streptomyces
FT                   coelicolor putative DNA-binding protein SCJ11.39c, 279 aa;
FT                   fasta scores: opt: 544 z-score: 640.7 E(): 3.8e-28; 40.2%
FT                   identity in 249 aa overlap. Contains Pfam match to entry
FT                   PF01381 HTH_3, Helix-turn-helix and possible
FT                   helix-turn-helix motif at residues 64..85 (+4.67 SD)"
FT                   /db_xref="GOA:Q9ADL0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADL0"
FT                   /protein_id="CAD30930.1"
FT                   /translation="MDGQLDRRAELSEFLRTRRARLKPEDVGLESYGRQRRVPGLRREE
FT                   LAQLAGVSVAYYTRLEQGNGQNVSAEVLDAIARALRLTDAEQAHLTHLARPKQQRRRAG
FT                   AARGKQPVRVALLQLLDSIDTVPAYVSGRRSEILAWNRMAAALFGDWGKLPAAERNWAR
FT                   LVFLNPDYRELFVDWDQKAYDMVSFLRMDAGRHPDDPRLSALVGELSVKSEEFRRLWAT
FT                   HDVKEKSYGVKRMRHPLVGDLTLSFETFRLVDDDEQAFITYHAEPGSPSADALRLLASW
FT                   GTDAAASLPA"
     atggatggac agcttgaccg gcgggccgaa ctgagcgagt tcctgcgcac ccggcgggcc        60
     cggctcaagc cggaggacgt gggtctggag tcgtacggac ggcagcgcag ggtgcccggg       120
     ctgcggcgcg aggagctggc gcagctggcc ggggtgtcgg tggcgtacta cacccgcctc       180
     gagcagggca acgggcagaa cgtgtcggcg gaggtcctgg acgccatcgc ccgggcgctg       240
     cggctgaccg acgccgagca ggcgcacctg acccatctgg cacggccgaa gcagcagcgc       300
     cggcgggccg gggccgcgcg gggcaagcag ccggtgcggg tggcgctgct ccagttgctg       360
     gattcgatcg acacggtgcc cgcgtacgtg tcgggccgcc gctcggagat tctcgcctgg       420
     aaccggatgg ccgcggccct cttcggcgac tggggcaagc tcccggccgc cgagcgcaac       480
     tgggcgcggc tggtcttcct gaacccggac taccgtgagc tgttcgtcga ctgggaccag       540
     aaggcgtacg acatggtcag cttcctgcgc atggacgcgg gccgccatcc ggacgacccg       600
     cgcctgtccg cgctggtcgg cgaactctcc gtgaagagcg aggagttccg ccgcctgtgg       660
     gccacgcacg acgtcaagga gaagagctac ggcgtcaagc ggatgcggca cccgctggtc       720
     ggcgacctga ccctgtcctt cgagacgttc cgcctggtcg acgacgacga acaggccttc       780
     atcacgtacc acgcggaacc cggctcgccg tcggcggacg cactgcgtct gctggcgagc       840
     tgggggacgg acgcggcggc ttccctgccg gcgtga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page