(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4946

AL939122.SCO4946     Location/Qualifiers
FT   CDS_pept        10116..10907
FT                   /transl_table=11
FT                   /gene="SCO4946"
FT                   /gene_synonym="2SCK31.06"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.06, hypothetical protein, len: 263 aa; highly
FT                   similar to TR:Q9L114 (EMBL:AL159139) Streptomyces
FT                   coelicolor hypothetical 27.0 kDa protein SCL6.02, 255 aa;
FT                   fasta scores: opt: 711 z-score: 830.9 E(): 0; 49.4%
FT                   identity in 253 aa overlap"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF2"
FT                   /protein_id="CAD30932.1"
FT                   /translation="MTYHASTPSTPLLVTGGTGTLGGHVVPLLREAGHDVRVLTRRTRP
FT                   ATGNGITYVTGDLRTGEGVEAAVDGVHTVLHLAGGPKGDDEATRTLVRAAARADVRHLA
FT                   YISVVGADRVPLAWLRTKLESERAIADSGLGWTVLRAAQFHELTLTMIEKMTRLPVLPV
FT                   PGGLRLQPVAAREVAVRLAELTLAEPSGRVPDMTGPEVLDLATLAHSYLDLRGGRRRPK
FT                   LPVRIPGKAGRAYRSGQNLTLEDALVGKVTWTEFLAERAAV"
     atgacgtacc acgcctcgac ccccagcacg cccctcctgg tcaccggagg caccggcacc        60
     ctcggcggcc acgtggtccc gctgctgcgg gaggccggcc acgacgtccg cgtcctcacc       120
     cggcggaccc gccccgccac cggtaacggc atcacgtacg tcaccggtga cctgcgcacc       180
     ggcgagggcg tcgaggccgc cgtcgacggc gtgcacaccg tgctccacct ggcgggcggc       240
     cccaagggcg acgacgaggc gacccgcacc ctggtccgcg ccgccgcccg cgcggacgta       300
     cggcacctcg cgtacatctc ggtcgtcgga gccgaccgcg tccccctcgc ctggctgcgg       360
     accaagctgg agtcggagcg ggcgatcgcc gactcgggcc tcggctggac ggtgctgcgg       420
     gcggcccagt tccacgagct gaccctgacg atgatcgaga agatgacccg gctgcctgtg       480
     ctcccggtgc ccggcgggct gcgtctgcaa ccggtcgccg cccgcgaggt cgccgtacgc       540
     ctggccgagc tgaccctcgc cgagccgtcc ggccgggtgc ccgacatgac cggacccgag       600
     gtcctcgatc tggccacgct ggcccattcc tatctggacc tgcgcggcgg gcgccggcgc       660
     ccgaagctgc cggtgcgcat tcccgggaaa gcggggcgcg cgtaccgttc tggccagaat       720
     ctcaccctgg aagacgcgct ggtcggcaag gtgacgtgga ccgaattcct ggcggagagg       780
     gcggccgtat ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page