(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4947

AL939122.SCO4947     Location/Qualifiers
FT   CDS_pept        11148..14831
FT                   /transl_table=11
FT                   /gene="SCO4947"
FT                   /gene_synonym="narG3"
FT                   /gene_synonym="2SCK31.07"
FT                   /product="nitrate reductase alpha chain NarG3"
FT                   /note="2SCK31.07, narG3, nitrate reductase alpha chain,
FT                   len: 1227 aa; highly similar to SW:NARG_BACSU (EMBL:Z49884)
FT                   Bacillus subtilis nitrate reductase alpha chain (EC
FT                   1.7.99.4)NarG, 1228 aa; fasta scores: opt: 4080 z-score:
FT                   4618.0 E(): 0; 49.5% identity in 1206 aa overlap and to
FT                   TR:O86717 (EMBL:AL031515) Streptomyces coelicolor NarG,
FT                   putative nitrate reductase alpha chain SC5C7.20, 1231 aa;
FT                   fasta scores: opt: 5648 z-score: 5294.1 E(): 0; 66.6%
FT                   identity in 1232 aa overlap. Contains Pfam matches to
FT                   entries PF00384 molybdopterin, Prokaryotic molybdopterin
FT                   oxidoreductases and PF01568 Molydop_binding, Molydopterin
FT                   dinucleotide binding domain and matches to Prosite entries
FT                   PS00551 Prokaryotic molybdopterin oxidoreductases signature
FT                   1 and PS00490 Prokaryotic molybdopterin oxidoreductases
FT                   signature 2"
FT                   /db_xref="GOA:Q9EWF3"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF3"
FT                   /protein_id="CAD30933.1"
FT                   /translation="MADAADRLLKAGQLLRRSPTTLDLRAVYRTDQNVNDRPYRERWAH
FT                   DKVVRSTHGVNCTGSCSWKVYVKDGLITWETQQTDYPSVGPDRPEYEPRGCPRGASFSW
FT                   YTYSPTRVRHPLARGVLVEMYRDAKRRHGGDPVAAWAELTSDPEKRRRYQSARGRGGFV
FT                   RVDWDEALEIAAAAQVHTIAEYGPDRVAGFSPIPAMSMASHAVGARYHSLIGAPMISFY
FT                   DWYADLPIASPQVFGDQTDVPESGDWWDAAYLMLWGSNVPVTRTPDAHWMAEARYRGQK
FT                   VVVVSPDYADATKFADEWLHPHPGTDGALAMAMGHVLLTEFFVRRQVPYFTDYVKRFTD
FT                   LPFLVALDEHAAGRWTPGKFVTAADLGLGRHADAGARAWMPVLIDADTDDVVVPNGTLG
FT                   DRWGKGGEGRWNLDLGGTDPLLTLHGHTGGRGDNGVEVVLPRFDEPGATVVRGVPAREI
FT                   GGRLVTTVYDLLLAQYAVARPGLAGHWPTGYDDAEQPCTPAWQERLTSVPAEAAVRAAR
FT                   EFARTAEQTRGRCMIVMGAGTNHWFHSDTIYRSFLSLLILTGCQGVNGGGWAHYVGQEK
FT                   VRPYTGWQQLSTAADWVRPSRQMAGTPYWYLHTGQWRYESHAADALASPTAPGTLAGLH
FT                   TADLVAQSARLGWMPSYPTFDANPLDLGRRARESGQEPGDWIAEQLGSGAVDFACEDPD
FT                   APRNWPRVLTVWRANLIGSSAKGNEYFLRHLLGARDGATSSEAPPEHRPRSVAWRDDAP
FT                   EGKLDLLLSLDFRMTSTTLFSDLVLPAATWYEKHDLSSTDMHPFVHAFSPAINPPWQAR
FT                   TDFEIFHSLARRLSELAAGRLGTAHDLVATALQHDTPGETAQPGGRVTDWRDGRTPIEP
FT                   GRNAPQVSLVERDYTAVADRLAAFGPLAEEHGMTVKGVTVNPHEESRWLAARCGTAPAG
FT                   PARGRPLLDTDVKFCEAILALSGTTNGRLAAEGFDRLADRVGPGAGLAELAASVGERRV
FT                   VFSDTQERPVQVGASFEWSGKEAPDRRYSPFTVNTEHKKPWHTLTGRQHFYVDHDWMAE
FT                   LGEQLPVYRPPLNLAELGDAPIPTGDGRAVTVRYLTPHAKWSIHSEYQENLLMQTLARG
FT                   GPVVWMSPADADAIGAADNDWVEAVNAHGVVVARAIVSHRVPDGTVLMYHVQERLVNVP
FT                   KSEANGRRGGVHNSLTKLLVKPTHLIGGYGQLSFAPNYYGPTGNQRDAVTTIRRRSQEV
FT                   TY"
     gtggccgacg ccgctgaccg gcttctgaag gcaggtcagc tgctgcggag gtcccctacc        60
     accctcgatc tgagggccgt gtaccgcacg gaccagaacg tcaacgaccg tccttatcgt       120
     gagcggtggg cgcatgacaa agtcgtgcgc tccacccatg gcgtcaactg cacgggatcg       180
     tgctcgtgga aggtgtacgt caaggacggt ctgatcacct gggagaccca gcagacggat       240
     tatccgagcg tcggtcccga ccggcccgag tacgagccgc gcggctgtcc gcgcggcgcc       300
     tccttttcct ggtacaccta ttcgcccacc cgtgttcgcc atccgttggc ccggggcgtc       360
     ctcgtggaaa tgtaccggga cgccaaacgc cggcacggcg gcgaccccgt ggccgcctgg       420
     gccgagctga cctccgaccc cgagaagcgg cgtcgctacc agtcggcccg cggccgcggc       480
     ggcttcgtcc gcgtcgactg ggacgaggcg ctggagatcg ccgccgccgc ccaggtgcac       540
     accatcgccg agtacggccc cgaccgggtc gccgggttct ccccgatccc cgccatgtcc       600
     atggcctcgc acgcggtcgg cgcccgctac cactccctca tcggcgcccc gatgatctcc       660
     ttctacgact ggtacgccga cctgccgatc gcctccccgc aggtcttcgg cgaccagacc       720
     gacgtaccgg agtcgggcga ctggtgggac gcggcctacc tgatgctgtg gggctccaac       780
     gtccccgtca cccgcacccc cgacgcgcac tggatggcgg aggcccgcta ccggggccag       840
     aaggtcgtcg tcgtctcgcc ggactacgcg gacgccacca agttcgccga cgagtggctg       900
     cacccgcacc ccggcaccga cggggcgctc gccatggcca tgggccacgt cctgctcacc       960
     gagttcttcg tgcgccgtca ggtgccgtac ttcaccgact acgtcaagcg cttcaccgac      1020
     ctgcccttcc tcgtcgccct cgacgagcac gcggcgggcc gctggacgcc cggcaagttc      1080
     gtcaccgccg ccgacctcgg gctcggccgg cacgccgacg ccggggcgcg ggcctggatg      1140
     ccggtgctga tcgacgccga caccgacgac gtggtcgtcc cgaacggcac cctcggcgac      1200
     cggtggggca agggcggcga ggggcgctgg aacctcgacc tgggcgggac cgacccgctc      1260
     ctcaccctgc acggacacac gggcggccgc ggtgacaacg gtgtcgaggt ggtgctgccc      1320
     cgcttcgacg aacccggcgc caccgtcgtg cgcggcgtac cggcccggga gatcggcggc      1380
     cggctcgtca ccaccgtcta cgacctcctc ctcgcccagt acgccgtcgc ccgccccggc      1440
     ctcgccggcc actggcccac cggctacgac gacgccgagc agccctgcac gcccgcctgg      1500
     caggagcgcc tcacctccgt cccggccgag gcggcggtcc gcgcggcccg ggagttcgcg      1560
     cgcaccgccg agcagacccg gggccgctgc atgatcgtca tgggcgccgg caccaaccac      1620
     tggttccact ccgacaccat ctaccggtcc ttcctctcgc tgctcatcct caccggctgc      1680
     cagggcgtca acggcggcgg ctgggcgcac tacgtcggcc aggagaaggt ccgcccgtac      1740
     accggctggc agcagctgtc cacggccgcc gactgggtcc ggccctcgcg gcagatggcg      1800
     ggcaccccgt actggtacct gcacaccggc cagtggcggt acgagtccca cgccgccgac      1860
     gccctcgcgt cgcccaccgc ccccggcacc ctcgccgggc tccacaccgc cgacctggtc      1920
     gcccagtccg cccggctcgg ctggatgccg tcctacccga ccttcgacgc caacccgctc      1980
     gacctcggcc gccgcgcccg cgagagcggc caggagcccg gtgactggat cgcggagcaa      2040
     ctcggttcgg gcgccgtgga cttcgcctgc gaggaccccg acgcgccccg caactggccg      2100
     cgcgtgctga ccgtgtggcg ggccaacctg atcggctcct ccgccaaggg caacgagtac      2160
     ttcctgcgcc acctgctcgg cgcccgcgac ggcgccacca gctccgaggc accgcccgag      2220
     caccggccgc gctccgtggc ctggcgggac gacgcccccg agggcaagct cgacctgctg      2280
     ctgagcctcg acttccggat gacctccacg acgctcttct ccgacctcgt gctgcccgcc      2340
     gccacctggt acgagaagca cgacctgtcc tccacggaca tgcacccctt cgtgcacgcc      2400
     ttcagtcccg cgatcaaccc gccctggcag gcccgcaccg acttcgagat cttccactcc      2460
     ctcgcccgcc gcctgagcga actcgccgcc ggccgcctcg gcacggccca cgacctggtc      2520
     gccaccgccc tccagcacga cacccccggc gagacggctc agcccggcgg ccgggtcacc      2580
     gactggcggg acggccgcac tcccatcgag ccgggccgca acgcccctca ggtctcgctg      2640
     gtggaacggg actacacggc cgtcgccgac cggctcgccg ccttcgggcc gctggccgag      2700
     gagcacggca tgaccgtgaa gggcgtgacc gtcaacccgc acgaggagtc gcgctggctc      2760
     gccgcccgct gcggcaccgc ccccgccggg cccgcccgcg gccgccccct gctcgacacc      2820
     gacgtcaagt tctgcgaggc gatcctcgcc ctgtccggca ccaccaacgg ccgcctcgcc      2880
     gccgagggct tcgaccgcct cgccgaccgc gtcgggcccg gcgccgggct cgccgagctc      2940
     gccgcgtcgg tgggggagcg gcgcgtggtc ttctccgaca cccaggagcg ccccgtgcag      3000
     gtcggggcga gcttcgagtg gtccggcaag gaggcgcccg accggcgcta ctcgcccttc      3060
     accgtcaaca ccgagcacaa gaagccctgg cacaccctca ccggccgcca gcacttctac      3120
     gtcgaccacg actggatggc cgagctgggc gagcagctcc ccgtctaccg gcccccgctg      3180
     aacctggccg agctgggcga cgccccgatc ccgaccggcg acggccgcgc ggtgaccgtc      3240
     cgctacctca ccccgcacgc caagtggtcc atccacagcg agtaccagga gaacctgctg      3300
     atgcagaccc tggcccgcgg cggccccgtc gtgtggatga gccccgccga cgccgacgcg      3360
     atcggcgccg ccgacaacga ctgggtggag gccgtcaacg cacacggcgt cgtcgtcgcc      3420
     cgcgcgatcg tctcccaccg cgtcccggac ggcacggtgc tcatgtacca cgtccaggaa      3480
     cgcctggtga acgtgccgaa gtcggaggcg aacggccgcc gcggcggtgt ccacaactcc      3540
     ctgaccaagc tgctcgtcaa gcccacccac ctcatcggcg gctacggcca gctctccttc      3600
     gcccccaact actacggccc gaccggcaac cagcgcgacg ccgtcaccac catccggcgc      3660
     cgctcccagg aggtcacgta ctga                                             3684
//

If you have problems or comments...

PBIL Back to PBIL home page