(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4948

AL939122.SCO4948     Location/Qualifiers
FT   CDS_pept        14840..16486
FT                   /transl_table=11
FT                   /gene="SCO4948"
FT                   /gene_synonym="narH3"
FT                   /gene_synonym="2SCK31.08"
FT                   /product="nitrate reductase beta chain NarH3"
FT                   /note="2SCK31.08, narH3, nitrate reductase beta chain, len:
FT                   548 aa; highly similar to SW:NARH_BACSU (EMBL:Z49884)
FT                   Bacillus subtilis nitrate reductase beta chain NarH, 487
FT                   aa; fasta scores: opt: 2088 z-score: 2047.9 E(): 0; 58.2%
FT                   identity in 483 aa overlap and to TR:O86716 (EMBL:AL031515)
FT                   Streptomyces coelicolor NarH, putative nitrate reductase
FT                   beta chain SC5C7.19, 531 aa; fasta scores: opt: 2542
FT                   z-score: 2343.2 E(): 0; 71.6% identity in 503 aa overlap"
FT                   /db_xref="GOA:Q9EWF4"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF4"
FT                   /protein_id="CAD30934.1"
FT                   /translation="MAQVAMVMNLDKCIGCHTCSVTCKQTWTNRTGTEYVWFNNVETRP
FT                   GQGYPRGHEDQEKWKGGWHLKGGRLVPRTGGRARRLARLFANPELPTLDDYYQPWTYDY
FT                   ENLTTAPLGDDIPTAPPRSAIDGRPTEITWGPNWDDDLGGGPAQLAADPLLARMSEQVR
FT                   LDYERAFMFYLPRICEHCLNPSCVAVCPSGALYKRVEDGIVLVDQDRCRGWRMCVSGCP
FT                   YKKVYFNHSTGKAEKCTFCYPRIEAGDPTVCSETCVGRLRYLGVMLYDPDKVGAAASVT
FT                   DEKDLYEAQLGCFLDPDDPEVARAAQASGIPHDWVEAARRSPVHALITRYRVALPLHPE
FT                   YRTMPMVWYVPPLSPVVDALTGTGHDGEDPAALFGAIDTLRIPLGYLAELFTAGDPGPV
FT                   EAALCRLAAMRSHMRRVNLGEEQDPRIAEAVGLDEPGILELYRLLALAKYDERYVIPTA
FT                   YTGSVPDPGGTGAGCSLDGVGGPGMMPEGAGGGPGFGEFDPEAFHAPPTAGSGTSSALR
FT                   GRVNLLNWNGKGRPNGLFPRARGAVRTEPEL"
     atggcacagg tggcgatggt catgaacctc gacaagtgca tcggctgcca cacctgctcg        60
     gtcacctgca aacagacctg gaccaaccgc accggcaccg agtacgtctg gttcaacaac       120
     gtcgagaccc gtcccggcca gggctacccc cgcggccacg aggaccagga gaagtggaag       180
     ggcggctggc acctcaaggg cgggcgcctc gtcccgcgca ccggcggccg cgcccgccgc       240
     ctcgcccgcc tcttcgccaa ccccgaactc cccaccctcg acgactacta ccagccctgg       300
     acctacgact acgagaacct caccaccgcc cccctcggcg acgacatccc caccgccccg       360
     ccccgctcgg cgatcgacgg ccgccccacc gagatcacct ggggccccaa ctgggacgac       420
     gacctcggcg gcggccccgc acagctcgcc gcggaccccc tcctcgcccg gatgagcgag       480
     caggtccggc tcgactacga gcgggcgttc atgttctacc tgccccgcat ctgcgagcac       540
     tgcctcaacc cgtcctgcgt cgccgtctgc ccctccggcg ccctctacaa gcgcgtcgag       600
     gacggcatcg tcctggtcga ccaggaccgc tgccggggct ggcggatgtg cgtcagcggc       660
     tgcccgtaca agaaggtcta cttcaaccac tccaccggca aggccgagaa gtgcaccttc       720
     tgctacccgc ggatcgaggc cggcgacccc accgtctgct ccgagacctg cgtcggccgg       780
     ctgcgctacc tcggcgtcat gctctacgac cccgacaagg tcggtgccgc cgcctccgtc       840
     accgacgaga aggacctgta cgaggcccag ctcggctgct tcctcgaccc cgacgacccc       900
     gaggtggccc gcgcggccca ggcgtccggc atcccgcacg actgggtcga ggccgcgcgc       960
     cgctccccgg tccacgcgct gatcacccgg taccgcgtcg cgctcccgct gcacccggag      1020
     taccgcacga tgccgatggt ctggtacgtc ccgccgctct ccccggtcgt cgacgccctc      1080
     accggcaccg ggcacgacgg ggaggacccg gccgcgctgt tcggcgcgat cgacacgctg      1140
     cgcatccccc tcggctacct cgccgaactc ttcaccgcgg gcgatccggg gcccgtcgag      1200
     gccgccctgt gccggctggc cgcgatgcgc tcccacatgc ggcgcgtcaa cctcggcgag      1260
     gaacaggacc cgcggatcgc cgaggcggtc gggctggacg agccgggcat cctggagctg      1320
     taccggctgc tcgccctcgc caagtacgac gagcgctacg tcatcccgac cgcctacacc      1380
     ggctccgtcc ccgaccccgg cggcaccggg gcgggctgca gcctggacgg cgtgggcggg      1440
     ccggggatga tgccggaggg cgcgggcggc ggccccggct tcggggagtt cgaccccgaa      1500
     gccttccacg cgccgccgac cgccgggtcc ggcacgtcgt ccgcgctgcg cggccgggtc      1560
     aacctcctga actggaacgg gaagggacgc ccgaacggcc tcttcccgcg cgcccgcggc      1620
     gccgtgcgga cggagcccga gctgtga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page