(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4950

AL939122.SCO4950     Location/Qualifiers
FT   CDS_pept        17142..17855
FT                   /transl_table=11
FT                   /gene="SCO4950"
FT                   /gene_synonym="narI3"
FT                   /gene_synonym="2SCK31.10"
FT                   /product="nitrate reductase gamma chain NarI3"
FT                   /note="2SCK31.10, narI3, nitrate reductase gamma chain,
FT                   len: 237 aa; highly similar to SW:NARI_BACSU (EMBL:Z49884)
FT                   Bacillus subtilis nitrate reductase gamma chain (EC
FT                   1.7.99.4) NarI, 223 aa; fasta scores: opt: 792 z-score:
FT                   991.9 E(): 0; 49.6% identity in 234 aa overlap and to
FT                   TR:Q9RI29 (EMBL:109989) Streptomyces coelicolor putative
FT                   nitrate reductase delta chain NarI2 SCJ12.31, 256 aa; fasta
FT                   scores: opt: 813 z-score: 891.7 E(): 0; 54.3% identity in
FT                   230 aa overlap. Contains possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q9EWF6"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF6"
FT                   /protein_id="CAD30936.1"
FT                   /translation="MRHLHTALWGVLPYLTLVVLVAGTAWRYRYDRFGFTTRSSQLHES
FT                   RLLRIAGPLFHYGLLFVIAGHVAGLLVPESLTDRLHVSEHLYHANALIAGGTAGLATLA
FT                   GLALLLYRRLRTPAIRAATSRSDRVVYPLLLTVVLAGLTATASGATAASTYDYRLGVSV
FT                   WFRSLFALDPDVTAMAQAPLVYRLHALLAMALFALWPYTRLIHAFTAPLGYLVRPYVVY
FT                   RYRGRGEVGAGRPGR"
     atgaggcacc tgcacaccgc cctgtggggc gtcctgccgt acctgaccct ggtggtgctg        60
     gtggcgggga cggcctggcg ctaccgctac gaccgtttcg gcttcaccac ccggtccagt       120
     cagctgcacg agagccggct gctgcggatc gcgggcccgc tcttccacta cggcctgctg       180
     ttcgtgatcg ccggccacgt ggccgggctc ctggtccccg agtcgctgac cgaccgcctc       240
     cacgtcagcg agcacctcta ccacgccaac gccctgatcg cgggcggcac cgcgggcctg       300
     gcgaccctgg cgggcctcgc cctcctcctg taccgccgcc tgcgcacccc cgcgatccgg       360
     gccgcgacca gccggagcga ccgagtggtc taccccctgc tgctcacggt cgtcctcgcc       420
     gggctgacgg ccaccgcgtc cggtgcgacg gcggcgtcca cgtacgacta ccggctcggc       480
     gtctccgtct ggttccgcag cctgttcgcg ctggacccgg acgtgaccgc catggcccag       540
     gccccgctcg tctaccgcct gcacgcactc ctcgccatgg ccctgttcgc cctgtggccc       600
     tacacgcgcc tgatccacgc cttcacggcg ccgctcggct acctggtgcg gccctacgtc       660
     gtgtaccgct accgggggcg cggcgaggtg ggagcgggcc ggccggggcg ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page