(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4952

AL939122.SCO4952     Location/Qualifiers
FT   CDS_pept        19080..19676
FT                   /transl_table=11
FT                   /gene="SCO4952"
FT                   /gene_synonym="2SCK31.12"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="2SCK31.12, probable tetR-family transcriptional
FT                   regulator, len: 198 aa; similar to TR:Q9RJL5
FT                   (EMBL:AL121849) Streptomyces coelicolor putative
FT                   tetR-family transcriptional regulator SCF6.16, 194 aa;
FT                   fasta scores: opt: 355 z-score: 451.5 E(): 1.3e-17; 35.1%
FT                   identity in 185 aa overlap. Contains Pfam match to entry
FT                   PF00440 tetR, Bacterial regulatory proteins, tetR family
FT                   and possible helix-turn-helix motif at residues 42..63
FT                   (+4.18 SD)"
FT                   /db_xref="GOA:Q9ADK8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK8"
FT                   /protein_id="CAD30938.1"
FT                   /translation="MKDGEAATGQAASRPKRADARRNEKNLLDAAAAVFVRSGVEAPVR
FT                   DIAAEAGVGTATIYRHFPTRADLIIGVYRHQVEACAEAGPALLASSPTPYAALAGWIDL
FT                   FVDFLVTKHGLAAVLQSDSAGFETLHAYFLDRLVPVCTDLLAAATDSGEIDTDVPPLAL
FT                   MRGVGNLCIGAETPNPSYDARQLVRILIAGLRAAD"
     gtgaaggacg gcgaagcggc aacgggacag gcggcctccc ggcccaagcg cgcggacgcc        60
     cggcgcaacg agaagaacct gctcgacgcc gccgccgcgg tgttcgtcag atcgggcgtg       120
     gaggcccccg tgcgcgacat cgcggccgag gccggggtcg gcacggccac gatctaccgt       180
     cacttcccga cccgggcgga cctcatcatc ggcgtctacc ggcaccaggt ggaggcctgt       240
     gccgaggccg gtcccgccct gctggcgagc agcccgaccc cgtacgcggc gctcgcgggc       300
     tggatcgacc tgttcgtcga cttcctggtc accaagcacg gcctcgccgc ggtcctccag       360
     tccgacagcg ccggcttcga gaccctccac gcgtacttcc tcgaccgcct cgtccccgtc       420
     tgcaccgacc tcctcgccgc cgccaccgac tccggcgaga tcgacactga cgtaccgccc       480
     ctggcgctca tgcgcggtgt cggcaacctc tgcatcggcg cggagacccc caacccgagt       540
     tacgacgccc ggcaactggt gcgcatcctg atcgcggggc tgcgcgcggc ggactga          597
//

If you have problems or comments...

PBIL Back to PBIL home page