(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4954

AL939122.SCO4954     Location/Qualifiers
FT   CDS_pept        complement(19941..20534)
FT                   /transl_table=11
FT                   /gene="SCO4954"
FT                   /gene_synonym="2SCK31.14c"
FT                   /product="hypothetical protein 2SCK31.14c"
FT                   /note="2SCK31.14c, unknown, len: 197 aa"
FT                   /db_xref="InterPro:IPR025633"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK6"
FT                   /protein_id="CAD30940.1"
FT                   /translation="MQQPQREVRAVHTASTVTVYQAYSPEIGLPAIREGRFPAAWKRDR
FT                   MTWIKPSFLWMMYRCGWAAKAGQETVLAVEIGREGFEWALRHACLSSYQPGVHPDRATW
FT                   QREVKRSPTRVQWDPERDLRLQPLPYRSLQLGLAGEAARRYADEWTVAIRDVTPLAHEI
FT                   HGLVRDGDLDAARRLLPREQPYPAAEELLSNLRP"
     atgcagcagc cccagcgcga ggtccgggcc gtccacaccg cgtccaccgt caccgtctac        60
     caggcgtact ccccggagat cggcctcccg gccatccgcg aaggacgctt ccccgccgcc       120
     tggaagcggg acaggatgac atggatcaag ccgtcgttcc tgtggatgat gtaccgctgc       180
     gggtgggccg ccaaggcggg gcaggagacc gttctggccg tggagatcgg ccgcgagggc       240
     ttcgagtggg ccctgcgcca cgcgtgcctg tcgagctacc agcccggcgt ccaccccgac       300
     cgggccacct ggcagcgcga ggtgaagcgc tcgcccaccc gcgtccagtg ggaccccgaa       360
     cgcgacctgc gcctccagcc cctgccctac cgctccctgc agctcggcct ggccggcgag       420
     gccgcgcgcc ggtacgccga cgagtggacg gtcgccatcc gcgacgtgac tccactcgcc       480
     cacgagatcc acggcctcgt ccgggacggc gacctcgacg cggcgcggcg cctgctgccc       540
     cgggagcagc cgtatcccgc cgcggaggaa ctgctgagca acctgcggcc gtga             594
//

If you have problems or comments...

PBIL Back to PBIL home page