(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4955

AL939122.SCO4955     Location/Qualifiers
FT   CDS_pept        complement(20665..21852)
FT                   /transl_table=11
FT                   /gene="SCO4955"
FT                   /gene_synonym="2SCK31.15c"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="2SCK31.15c, hypothetical protein, len: 395 aa;
FT                   similar to TR:Q9X8V7 (EMBL:AL078610) Streptomyces
FT                   coelicolor hypothetical 43.9 kDa protein SCH35.49c, 410 aa;
FT                   fasta scores: opt: 1788 z-score: 1973.1 E(): 0; 63.8%
FT                   identity in 398 aa overlap. Contains match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK5"
FT                   /protein_id="CAD30941.1"
FT                   /translation="MGLALAGAGLATVGTAPAAAGSYDCPSGYFCGWTGESANGSMWKT
FT                   NKSVADLGGWDNKIRSYVNRTTSVACVYEDKNYTPWGGYWAQEPNSPGEYNGDPVATTS
FT                   SVKFVRTERECSQPAYPSWSSETSPKALGFGDLNGDRRADVVTRDEAGRLWFSPGDTTG
FT                   RLIGTGGWNAMSALTRHGDFSRDGREDLIAREASTGKLWLYPGTGTGSLGSRKLIGKSG
FT                   WNAMNRVTAFGDLTGDGRSDLIAVEKATARLWLYPGTSTGTLGARKLIGKSGWNAMNAL
FT                   IGMGDVTGDGRPDLYAREASTGKLWLYPGTSTGTLGSRTLVGTGGWNAMAHFLPVGDFS
FT                   GDGVPDLATVTNEKYVLDGYPGNLGWLVTYRGRGNGFLTSGVPTHGEWWGLNGFV"
     gtgggcctcg cgctcgccgg tgcgggcctg gccaccgtgg gcaccgctcc ggcggcggcc        60
     ggctcgtacg actgtccgtc gggctacttc tgcggctgga cgggcgagag cgccaacggc       120
     tcgatgtgga agacgaacaa gagcgtcgcg gacctgggcg gctgggacaa caagatccgc       180
     tcgtacgtca accgcacgac gagtgtcgcc tgcgtctacg aggacaagaa ctacacgccg       240
     tggggcggtt actgggccca ggagccgaac tcgcccggcg aatacaacgg ggacccggtc       300
     gcgaccacca gctcggtcaa gttcgtccgc accgagcgcg agtgcagtca gcccgcctat       360
     cccagctggt cctccgagac ctcaccgaag gccctgggct tcggtgacct gaacggtgac       420
     cgcagggccg acgtcgtcac ccgcgacgag gccggacggc tctggttctc cccgggcgac       480
     accaccggcc ggctgatcgg caccggcggc tggaacgcca tgagcgccct cacccggcac       540
     ggtgacttca gccgcgacgg gcgcgaggac ctgatcgccc gcgaggcctc gaccggcaag       600
     ctctggctct accccggcac cggaaccggt tccctcggtt cccgcaagct gatcggcaag       660
     agtggctgga acgccatgaa ccgggtcacc gctttcggtg acctgaccgg tgacggccgc       720
     tccgacctga tcgcggtcga gaaggccacg gccaggctct ggctctaccc gggcacctcc       780
     accggcaccc tcggcgcccg caagctgatc ggcaagagcg gctggaacgc catgaacgcg       840
     ctgatcggca tgggcgacgt gaccggcgac ggccggcccg acctctacgc acgcgaggcg       900
     tccaccggca agctgtggct ctacccgggc acctcgacgg gcaccctcgg ttcccgcacg       960
     ctcgtcggga ccggcggctg gaacgcgatg gcgcacttcc tcccggtcgg cgacttctcc      1020
     ggcgacggcg tgccggacct ggccaccgtg accaacgaga agtacgtact ggacggctac      1080
     ccgggcaacc tgggctggct ggtcacctac cggggccgcg gcaacggttt tctgacgtcc      1140
     ggcgtaccca cccacgggga gtggtgggga ctcaacggct tcgtctag                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page