(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4956

AL939122.SCO4956     Location/Qualifiers
FT   CDS_pept        22010..22528
FT                   /transl_table=11
FT                   /gene="SCO4956"
FT                   /gene_synonym="2SCK31.16"
FT                   /product="putative peptide methionine sulfoxide reductase"
FT                   /note="2SCK31.16, probable peptide methionine sulfoxide
FT                   reductase, len: 172 aa; similar to SW:PMSR_ECOLI
FT                   (EMBL:M89992) Escherichia coli peptide methionine sulfoxide
FT                   reductase MsrA, 211 aa; fasta scores: opt: 437 z-score:
FT                   538.0 E(): 2e-22; 44.2% identity in 165 aa overlap.
FT                   Contains Pfam match to entry PF01625 PMSR, Peptide
FT                   methionine sulfoxide reductase"
FT                   /db_xref="GOA:Q9EWF7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EWF7"
FT                   /protein_id="CAD30942.1"
FT                   /translation="MAAQTQRAVLAGGCFWGMEELIRRLPGVTATRVGYTGGDVPNATY
FT                   RNHGTHAEAIEILFDPEATDYRALLEFFFQIHDPSTKNRQGNDIGLSYRSAIYYVDDEQ
FT                   KRIAEDTIADVDASGLWPGKVVTEVEPVGPFWEAEPEHQDYLQRYPDGYTCHFPRPGWR
FT                   LPARSGSEG"
     atggctgcgc agacacagag ggccgtgctg gcgggcggat gcttctgggg gatggaggag        60
     ctgatccgtc ggcttccggg cgtgaccgcg acccgggtcg gatacaccgg cggtgacgtg       120
     ccgaacgcga cgtaccggaa ccacggcacg cacgcggagg ccatcgagat cctcttcgat       180
     cccgaggcga ccgactaccg cgcactcctg gagttcttct tccagatcca cgacccgagc       240
     accaagaacc gccagggcaa cgacatcggc ctcagctacc gctcggcgat ctactacgtg       300
     gacgacgagc agaagcggat cgccgaggac acgatcgccg acgtggacgc ctccggactg       360
     tggcccggca aggtcgtcac cgaggtggag ccggtcggcc ccttctggga ggcggagccg       420
     gagcaccagg actacctgca gcgctacccg gacgggtaca cctgccactt cccgcgcccg       480
     ggctggcggc tgcccgcccg cagcggcagc gagggctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page