(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4957

AL939122.SCO4957     Location/Qualifiers
FT   CDS_pept        complement(22632..23750)
FT                   /transl_table=11
FT                   /gene="SCO4957"
FT                   /gene_synonym="2SCK31.17c"
FT                   /product="putative membrane protein"
FT                   /note="2SCK31.17c, putative membrane protein, len: 372 aa;
FT                   similar to TR:Q9S2T3 (EMBL:AL096884) Streptomyces
FT                   coelicolor hypothetical 40.5 kDa protein SC4G6.25, 376 aa;
FT                   fasta scores: opt: 334 z-score: 393.9 E(): 2.1e-14 34.3%
FT                   identity in 324 aa overlap. Contains possible hydrophobic
FT                   membrane spanning region"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF8"
FT                   /protein_id="CAD30943.1"
FT                   /translation="MEILWVLMALVMLGFVLLQVSRRRRGAVGLVEPGHPDAADPANYG
FT                   FAREEELDIRMPGPDQDLLDVLDLVQRTQDYRGAMQLLAGTEAEGERRWQRVQAFAGAA
FT                   SLELRQRPGGVGETPGGQWLRVWRAEAPKDAGGAAVHAEFLVQQAWRTSTPGSDDFRII
FT                   MEEARAACGEAALLAPGDPVPYIVELSVARGLGYSREEFEQLWLKILDRAPNHMGAHLA
FT                   ALQYWCEKWHGSRQLAYSFAEAAAARAPRGSLLAAMPLFAVFEHLPEVNLVSGFYQSEV
FT                   VTKAVHGALHAVHSARPDDPMQAHVRHLLVFFLVRGERWAEAMNQLTVIDGHVGALPWT
FT                   LSTDPAAEFAVYRALAVAGYEANGGSPATLPH"
     atggagattc tctgggtcct gatggcactg gtcatgctcg gcttcgtgct gctccaagtc        60
     tcgcggcgcc ggcgcggcgc ggtcggcctg gtcgagcccg gccacccgga cgccgccgac       120
     cccgcgaact acggcttcgc ccgcgaggag gagctggaca tccggatgcc gggccccgac       180
     caggacctgc tcgacgtcct ggacctggtg cagcgcaccc aggactaccg gggggcgatg       240
     cagctcctcg ccgggacgga ggcggagggc gagcggcgct ggcagcgcgt gcaggccttc       300
     gcgggagccg cgtcgctgga gctgcggcag cggcccggcg gtgtcgggga gacgccgggc       360
     gggcagtggc tgcgggtgtg gcgggccgag gcgcccaagg acgcgggcgg cgcggcggtg       420
     cacgccgagt tcctggtgca gcaggcgtgg cggacgtcga cgccgggctc ggacgacttc       480
     cggatcatca tggaggaggc cagggcggcc tgcggcgagg cggccctcct cgcacccggg       540
     gacccggtcc cgtacatcgt cgagctgtcg gtggcccgcg gcctcgggta ctcgcgcgag       600
     gagttcgagc agctctggct gaagatcctg gaccgcgccc ccaaccacat gggcgcgcac       660
     ctggccgcgt tgcagtactg gtgcgagaag tggcacggct cgcggcagct ggcgtactcc       720
     ttcgcggagg cggcggccgc ccgcgccccg cggggctcgt tgctcgcggc gatgccgctc       780
     ttcgcggtct tcgagcacct gcccgaggtc aacctggtca gcggtttcta ccagagcgag       840
     gtcgtcacca aggccgtcca cggcgccctg cacgcggtcc actcggcccg cccggacgac       900
     cccatgcagg cgcacgtccg ccaccttctg gtgttcttcc tggtacgcgg cgagcgctgg       960
     gccgaggcca tgaaccagct gacggtcata gacggccacg tgggcgccct gccctggacg      1020
     ctgtccaccg acccggcggc ggagttcgcg gtgtaccgcg cgctcgcggt ggcgggatac      1080
     gaggcgaacg gcggcagccc ggccacgctg ccgcactga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page