(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4958

AL939122.SCO4958     Location/Qualifiers
FT   CDS_pept        23841..25001
FT                   /transl_table=11
FT                   /gene="SCO4958"
FT                   /gene_synonym="metB"
FT                   /gene_synonym="2SCK31.18"
FT                   /product="cystathionine gamma-synthase"
FT                   /note="2SCK31.18, metB, cystathionine gamma-synthase, len:
FT                   386 aa; highly similar to TR:Q9RQ97 (EMBL:AF126953)
FT                   Corynebacterium glutamicum cystathionine gamma-synthase
FT                   MetB, 396 aa; fasta scores: opt: 1497 z-score: 1715.4 E():
FT                   0; 59.2% identity in 377 aa overlap. Contains Pfam match to
FT                   entry PF01053 Cys_Met_Meta_PP, Cys/Met metabolism
FT                   PLP-dependent enzyme and match to Prosite entry PS00179
FT                   Aminoacyl-transfer RNA synthetases class-II signature 1"
FT                   /db_xref="GOA:Q9EWF9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF9"
FT                   /protein_id="CAD30944.1"
FT                   /translation="MPMSDRHISQHFETLAIHAGNTADPLTGAVVPPIYQVSTYKQDGV
FT                   GGLRGGYEYSRSANPTRTALEENLAALEGGRRGLAFASGLAAEDCLLRTLLRPGDHVVI
FT                   PNDAYGGTFRLFAKVATRWGVEWSVADTSDAAAVRAALTPKTKAVWVETPSNPLLGITD
FT                   IAQVAQVARDAGARLVVDNTFATPYLQQPLALGADVVVHSLTKYMGGHSDVVGGALIVG
FT                   DQELGEELAFHQNAMGAVAGPFDSWLVLRGTKTLAVRMDRHSENATKVADMLSRHARVT
FT                   SVLYPGLPEHPGHEVAAKQMKAFGGMVSFRVEGGEQAAVEVCNRAKVFTLGESLGGVES
FT                   LIEHPGRMTHASAAGSALEVPADLVRLSVGIENADDLLADLQQALG"
     gtgcccatga gcgacaggca catcagtcag cacttcgaga cgctcgcgat ccacgcgggc        60
     aacaccgccg atcccctgac gggcgcggtc gtcccgccga tctatcaggt gtcgacctac       120
     aagcaggacg gcgtcggcgg attgcgcggc ggctacgagt acagccgcag cgccaacccg       180
     acccgtaccg cgctggagga gaacctcgcc gccctggagg gcggccgccg cggcctcgcg       240
     ttcgcgtccg gactggcggc cgaggactgc ctgttgcgta cgctgctgcg ccccggcgac       300
     cacgtggtga tcccgaacga cgcgtacggc ggcaccttcc gcctcttcgc caaggtcgcc       360
     acccggtggg gtgtggagtg gtccgtggcc gacacgagcg acgccgccgc cgtgcgggcc       420
     gccctcaccc cgaagaccaa ggcggtgtgg gtggagacgc cctccaaccc gctgctcggc       480
     atcaccgaca tcgcgcaggt cgcccaggtc gcccgggacg ccggcgcccg gctcgtcgtc       540
     gacaacacct tcgccacccc gtacctccag cagccgctgg ccctcggcgc cgacgtcgtc       600
     gtgcactcgc tgaccaagta catgggcggg cactcggacg tcgtgggcgg cgcgctgatc       660
     gtgggcgacc aggagctggg cgaggagctg gcgttccacc agaacgcgat gggcgcggtc       720
     gccggaccct tcgactcctg gctggtgctg cgcggcacca agaccctcgc cgtgcgcatg       780
     gaccggcaca gcgagaacgc gaccaaggtc gccgacatgc tctcccggca cgcgcgcgtg       840
     acgagcgtgc tgtacccggg gctgcccgag cacccggggc acgaggtcgc cgccaagcag       900
     atgaaggcgt tcggcggcat ggtgtcgttc cgcgtcgagg gcggcgagca ggccgccgtc       960
     gaggtgtgca accgcgcgaa ggtcttcacg ctcggcgagt ccctcggcgg cgtcgagtcg      1020
     ctgatcgagc acccgggccg gatgacgcac gcctccgcgg cgggctcggc cctggaggtg      1080
     cccgccgacc tggtgcggct gtcggtcggc atcgagaacg ccgacgacct gctggccgac      1140
     ctccagcagg cgctgggcta g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page