(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4961

AL939122.SCO4961     Location/Qualifiers
FT   CDS_pept        complement(26005..26505)
FT                   /transl_table=11
FT                   /gene="SCO4961"
FT                   /gene_synonym="2SCK31.21c"
FT                   /product="putative marR-family transcriptional regulator"
FT                   /note="2SCK31.21c possible marR-family transcriptional
FT                   regulator, len: 166 aa; similar to SW:YXAD_BACSU
FT                   (EMBL:AB005554) Bacillus subtilis hypothetical
FT                   transcriptional regulator in AsnH-GntR intergenic region
FT                   YxaD, 143 aa; fasta scores: opt: 268 z-score: 338.9 E():
FT                   2.4e-11; 35.0% identity in 137 aa overlap. Contains Pfam
FT                   match to entry PF01047 MarR, MarR family and possible
FT                   helix-turn-helix motif at residues 58..79 (+2.70 SD)"
FT                   /db_xref="GOA:Q9EWG2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG2"
FT                   /protein_id="CAD30947.1"
FT                   /translation="MDMTTAGDTGLLETLQHEVALFARRAEQTRLGGVGQVRNSMDRAA
FT                   YLLLNRLDKEGPMGVKALAASMGIDSSTVTRQVAPLVDTGLVKRTSHPEDGRAVVLQLS
FT                   PRGVARLEEVRSSRRQLMAELTHDWAPQERETFCALLARFNGALSARMAPSGVSPTDAP
FT                   SGS"
     atggacatga cgaccgccgg tgacaccggt cttctcgaga cgctccagca cgaggtcgcg        60
     ctcttcgccc gacgtgccga acagacccgg ctcggcgggg tcggccaggt gcgcaactcc       120
     atggaccgcg ccgcctacct gctgctcaac cgcctcgaca aagaaggccc gatgggcgtg       180
     aaggcgctcg ccgccagcat ggggatcgac tcctcgacgg tcacccggca ggtggccccg       240
     ctcgtcgaca ccggactcgt caagcggacc tcgcaccccg aggacggacg cgcggtggtc       300
     ctccagctgt cgccgcgcgg cgtggcgcgg ctggaggagg tccgctcctc ccggcgtcag       360
     ctcatggccg agctgaccca cgactgggcg ccgcaggagc gcgagacgtt ctgtgcgctc       420
     ctcgcgcgct tcaacggagc cctgtccgcc cgtatggccc cttccggcgt gtcgcccacg       480
     gacgccccct cgggctcctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page