(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4963

AL939122.SCO4963     Location/Qualifiers
FT   CDS_pept        28064..29071
FT                   /transl_table=11
FT                   /gene="SCO4963"
FT                   /gene_synonym="2SCK31.23"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="2SCK31.23, possible ABC transporter ATP-binding
FT                   protein, len: 335 aa; similar to TR:CAC08315
FT                   (EMBL:AL392149) Streptomyces coelicolor putative ABC
FT                   transport system ATP-binding protein SCD19A.14, 336 aa;
FT                   fasta scores: opt: 1211 z-score: 1254.5 E(): 0; 58.2%
FT                   identity in 330 aa overlap. Contains Pfam match to entry
FT                   PF00005 ABC_tran, ABC transporter and match to Prosite
FT                   entry PS00017 ATP/GTP-binding site motif A (P-loop) and
FT                   PS00211 ABC transporters family signature"
FT                   /db_xref="GOA:Q9AD75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AD75"
FT                   /protein_id="CAC21637.3"
FT                   /translation="MPGAIYAEGLVKTFGDVRALDGVDLDVPEGTVLGLLGPNGAGKTT
FT                   AVRCLTTLLRPDSGKAVVAGIDVLRQPNEVRRSIGLSGQFAAVDEYLTGRENLHMVGQL
FT                   YQMKGKAAKARAAELLDQFHLSDAADRPTKTYSGGMRRRLDLAAALVVSPPVMFMDEPT
FT                   TGLDPRNRQELWEVIKQLVAGGTTLLLTTQYLEEADHLAHDIAVVDHGRVIARGTSDQL
FT                   KARTGGERVEVVVHDRGRMATASDVLAGFGKGSTTVEEHTRKLTVPVTGGAKLLAEVIR
FT                   ELDVRGIEIDDIGLRRPTLDDVFLSLTGHVAEAADETNGSADDADHEQEKETAK"
     atgccaggcg ccatctatgc cgaaggcctg gtgaagacct tcggtgacgt aagggctctc        60
     gacggcgtcg acctcgacgt tcccgagggc acggtcctgg gcctgctcgg gccgaacggc       120
     gcgggcaaga ccaccgccgt ccgctgcctc acgaccctgc tgcgccccga cagcggcaag       180
     gcggtcgtcg cgggcatcga cgtcctcagg cagcccaacg aggtacgccg ctccatcggc       240
     ctctccggcc agttcgccgc ggtcgacgag tacctgacgg gccgcgagaa cctgcacatg       300
     gtcggccagc tctaccagat gaagggcaag gcggcgaagg cgcgggccgc cgagctgctc       360
     gaccagttcc acctctcgga cgccgccgac cgccccacca agacgtactc gggaggcatg       420
     cgccgccggc tcgacctggc ggccgccctg gtcgtctccc cgcccgtcat gttcatggac       480
     gaacccacga ccggcctgga cccccgcaac cggcaggagc tgtgggaggt catcaagcag       540
     ctggtcgcgg gcggtacgac cctcctgctc accacccagt acctggaaga ggccgaccac       600
     ctcgcgcacg acatcgcggt cgtcgaccac ggccgcgtca tcgcccgggg cacctccgac       660
     cagctcaagg cccgcaccgg gggagagcgc gtcgaggtcg tggtccacga ccgcggccgc       720
     atggcgacgg cctccgacgt gctcgccgga ttcggcaagg gctcgaccac ggtcgaggag       780
     cacacccgca agctgaccgt gcccgtcacg ggcggcgcga agctgctcgc cgaggtcatc       840
     cgcgaactcg acgtccgcgg tatcgagatc gacgacatcg gcctgcgccg ccccaccctc       900
     gacgacgtct tcctctccct caccggccac gtggccgagg cggcggacga gacgaacggc       960
     tcggcggacg acgccgacca cgagcaggag aaggagaccg ccaagtga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page