(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4964

AL939122.SCO4964     Location/Qualifiers
FT   CDS_pept        29068..29925
FT                   /transl_table=11
FT                   /gene="SCO4964"
FT                   /gene_synonym="2SCK31.24"
FT                   /product="putative integral membrane transport protein"
FT                   /note="2SCK31.24, probable integral membrane transport
FT                   protein, len: 285 aa; similar to TR:AAG32069
FT                   (EMBL:AF317791) Streptomyces viridochromogenes hydrophobic
FT                   transmembrane protein AviABCII, 265 aa; fasta scores: opt:
FT                   677 z-score: 786.2 E(): 0; 39.7% identity in 262 aa
FT                   overlap. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q9ADK3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK3"
FT                   /protein_id="CAD30949.1"
FT                   /translation="MSAATDAAPVTASANPIGQSVRDSLVIARRNLIRMTRIPEMVLFG
FT                   IIQPVMFVILFTYVFGGSIKVGSTTDSDVYKDFLMAGIFAQTVTFATAGSAAGIADDMQ
FT                   KGLVDRFRSLPMARGAVLTGRTVADLVQTSITLLVLAIVALLVGWRTGSAEPTNIGRVL
FT                   AGFGLLLLLGYAFTWIGALIGLSVRTPEAATSGGIIWLFPVTFVSNAFVDPTQMTPWLR
FT                   HVAEWNPFSAVVQACRELFGNPGVVQSDAWPMQHPVWATLTYSIVIVLIFRTLAVRKYR
FT                   RAAG"
     gtgagtgccg ccaccgacgc cgcgccggtc acggcgtccg ccaaccccat cggccagtcc        60
     gtccgtgact cgctggtcat cgcccgccga aacctgatcc ggatgacccg gatcccggag       120
     atggtcctgt tcgggatcat ccagccggtg atgttcgtca tcctgttcac gtacgtcttc       180
     ggcggttcca tcaaggtcgg cagcaccacc gactcggacg tctacaagga cttcctgatg       240
     gcgggcatct tcgcgcagac cgtcaccttc gccaccgccg gatcggcggc cggtatcgcc       300
     gacgacatgc agaaggggct cgtcgatcgc ttccggtccc tgccgatggc gcgaggcgcg       360
     gtgctgaccg ggcggacggt cgcggacctg gtgcagacgt cgatcaccct gctcgtcctg       420
     gcgatcgtcg cgctgctcgt gggctggcgc accggatcgg cggagccgac caacatcggg       480
     agggtgctcg cgggcttcgg gctgcttctg ctcctggggt acgccttcac gtggatcggc       540
     gccctgatcg gcctgtccgt acggacgccg gaggcggcga cctccggagg gatcatctgg       600
     ctgttccccg tcaccttcgt gtccaacgcc ttcgtcgacc ccacccagat gacgccgtgg       660
     ctccgccatg tcgccgagtg gaacccgttc agcgcggtcg tccaggcgtg ccgcgagctg       720
     ttcgggaacc cgggcgtcgt gcagtcggac gcctggccca tgcagcaccc ggtctgggcg       780
     acgcttacct actcgatcgt gatcgtcctg atcttcagga cactggcagt gcgcaagtac       840
     cgcagagcgg ccggctga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page