(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4965

AL939122.SCO4965     Location/Qualifiers
FT   CDS_pept        complement(30027..30524)
FT                   /transl_table=11
FT                   /gene="SCO4965"
FT                   /gene_synonym="2SCK31.25c"
FT                   /product="putative transcription elongation factor"
FT                   /note="2SCK31.25c, probable transcription elongation
FT                   factor, len: 165 aa; similar to SW:GREA_ECOLI (EMBL:X54718)
FT                   Escherichia coli transcription elongation factor GreA
FT                   (transcript cleavage factor), 158 aa; fasta scores: opt:
FT                   265 z-score: 326.5 E(): 1.2e-10; 34.0% identity in 153 aa
FT                   overlap. Contains Pfam match to entry PF01272 GreA_GreB,
FT                   Prokaryotic transcription elongation factor, GreA/GreB and
FT                   match to Prosite entry PS00830 Prokaryotic transcription
FT                   elongation factors signature 2"
FT                   /db_xref="GOA:Q9ADK2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ADK2"
FT                   /protein_id="CAD30950.1"
FT                   /translation="MTQTSENVTWLTQEAYNKLKEELEYLTGPARTEISAKIAAAREEG
FT                   DLRENGGYHAAKEEQGKQELRVRQLTQLLESAKVGEAPAADGVVAPGMVVTIAFDGDED
FT                   DTLTFLLASREYASSDIETYSPQSPLGSGVLGHKVGDDAQYELPNGKPASVRILKAEPY
FT                   NG"
     gtgacccaga ccagcgagaa cgtcacctgg ctgacccagg aggcgtacaa caagctcaag        60
     gaggagcttg aataccttac tggtcctgcg cgcaccgaga tctctgccaa gatcgccgcg       120
     gctcgtgagg agggggacct gcgggagaac ggcgggtacc acgcggcgaa ggaggagcag       180
     ggcaagcagg agctccgcgt gcgccagctg acccagctgc tcgagagcgc caaggtgggc       240
     gaggccccgg ctgccgacgg cgtcgtggcg cccggcatgg tcgtcaccat cgccttcgac       300
     ggcgacgagg acgacacgct gaccttcctg ctcgcttcgc gcgagtacgc gagctcggac       360
     atcgagacgt actctccgca gtccccgctc ggctcgggcg tcctcggcca caaggtcggc       420
     gacgacgcgc agtacgagct gcccaacggc aagcctgcct cggtgaggat cctcaaggcc       480
     gagccgtaca acggctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page