(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4967

AL939122.SCO4967     Location/Qualifiers
FT   CDS_pept        31234..32115
FT                   /transl_table=11
FT                   /gene="SCO4967"
FT                   /gene_synonym="2SCK31.27"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.27, conserved hypothetical protein, len: 293
FT                   aa; highly similar to TR:O53430 (EMBL:AL021897)
FT                   Mycobacterium tuberculosis hypothetical 32.7 kDa protein
FT                   MTV017.35, 288 aa; fasta scores: opt: 992 z-score: 1173.4
FT                   E(): 0; 52.3% identity in 287 aa overlap"
FT                   /db_xref="GOA:Q9ADK0"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017811"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ADK0"
FT                   /protein_id="CAD30952.1"
FT                   /translation="MTDQLRLMAVHAHPDDESSKGAATMAKYVSEGVDVLVVTCTGGER
FT                   GSILNPKLQGDAYIEENIHEVRRKEMDEAREILGVGQEWLGFVDSGLPEGDPLPPLPEG
FT                   CFALEDVDKAAGELVRKIRSFRPQVITTYDENGGYPHPDHIMTHKITMVAFEGAADTEK
FT                   YPESEYGTAYQPLKVYYNQGFNRPRTEALHHALLDRGLESPYEDWLKRWSEFERKERTL
FT                   TTHVPCADFFEIRDKALIAHATQIDPEGGWFRVPMEIQKEVWPTEEYELAKSLVETSLP
FT                   EDDLFAGIRDNA"
     ttgactgacc agctgcgact gatggccgtt cacgcccacc ccgacgacga gtcgagcaag        60
     ggcgcggcca ccatggcgaa gtacgtgtcc gagggggtgg acgtgctggt ggtgacctgc       120
     acgggcgggg agcgcggctc catcctcaac ccgaagctcc agggggacgc gtacatcgag       180
     gagaacatcc acgaggtgcg ccggaaggag atggacgagg cccgggagat cctgggcgtg       240
     gggcaggagt ggctcggctt cgtcgactcc gggctgcccg agggcgaccc gctgccgccg       300
     ctgccggagg gctgcttcgc cctggaggac gtcgacaagg cggccggcga gctggtgcgg       360
     aagatccgct ccttccggcc ccaggtgatc accacctacg acgagaacgg cggctacccg       420
     caccccgacc acatcatgac ccacaagatc acgatggtgg cgttcgaggg cgcggcggac       480
     accgagaagt acccggagag cgagtacgga acggcgtacc agccgctgaa ggtctactac       540
     aaccagggct tcaaccggcc ccgcaccgag gcgctgcacc acgcgctgct ggaccgcggc       600
     ctggagtcgc cctacgagga ctggctcaag cgctggtcgg agttcgagcg caaggagcgc       660
     accctcacca cgcacgtgcc ctgcgcggac ttcttcgaga tccgcgacaa ggcgctgatc       720
     gcgcacgcca cgcagatcga ccccgagggg ggctggttcc gggtgccgat ggagatccag       780
     aaggaggtct ggccgaccga ggagtacgag ctggccaagt ccctcgtgga aacctccctc       840
     cccgaggacg acctcttcgc gggcatccgg gacaatgcct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page