(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4971

AL939122.SCO4971     Location/Qualifiers
FT   CDS_pept        36195..37688
FT                   /transl_table=11
FT                   /gene="SCO4971"
FT                   /gene_synonym="2SCK31.31"
FT                   /product="putative dehydrogenase"
FT                   /note="2SCK31.31, possible dehydrogenase, len: 497 aa;
FT                   similar to N-terminal domain of SW:XDH_MOUSE (EMBL:X75129)
FT                   Mus musculus xanthine dehydrogenase/oxidase Xdh, 1335 aa;
FT                   fasta scores: opt: 345 z-score: 361.7 E(): 1.3e-12 31.5%
FT                   identity in 483 aa overlap and to TR:O54050 (EMBL:AJ001013)
FT                   Rhodobacter capsulatus xanthine dehydrogenase (EC
FT                   1.1.1.204) XdhA, 462 aa; fasta scores: opt: 631 z-score:
FT                   669.1 E(): 9.8e-30; 38.2% identity in 495 aa overlap.
FT                   Contains Pfam matches to entries PF00111 fer2, 2Fe-2S
FT                   iron-sulfur cluster binding domains, PF01799 fer2_2,
FT                   [2Fe-2S] binding domain and PF00941 dehydrog_molyb,
FT                   Molybdopterin binding domain in dehydrogenase and match to
FT                   Prosite entry PS00197 2Fe-2S ferredoxins, iron-sulfur
FT                   binding region signature"
FT                   /db_xref="GOA:Q9EWG7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG7"
FT                   /protein_id="CAD30956.1"
FT                   /translation="MVTARITVNGKESPIAPAAPHTTVLDFLRERGLTGTKEGCAEGEC
FT                   GACSVLVARPGVNKPTDWVPVNACLVPVAALDGQEVVTSEGLATVEAPGTPPVLHPVQE
FT                   EMAVRGGSQCGYCTPGFVCSMAAEYYRPDRCAHADPGPDATAAADGAEGGDAEHGPNGF
FT                   DLHALSGNLCRCTGYRPIRDAAFAVGTPTDEDPLARRREQDPPAPVATEYRQDDSAFLR
FT                   RSTLAETLRLLRERPQAVVVAGSTDWGVEVNIRSRRADCVVAVDRLPELRDLRVESDHV
FT                   EIGAALTLTEIERRLDGSVPLLAQLFPQFASRLIRNGATLGGNLGTGSPIGDSPPVLLA
FT                   LEASLVLADADGEREVPLADYFTGYRQSVRRPGELIRAVRVPLPLSPVTAFHKIAKRRF
FT                   DDISSLAVAFALDVEGGTVRKARIGLGGVAATPVRALATEAALEGRPWTTGTAEAAAEV
FT                   LRGEGTPMSDHRASARYRAAMLGQSLLKLYAQTTEAVPS"
     atggtgaccg cacggatcac ggtcaacgga aaagaatcgc ccatcgcacc ggccgccccg        60
     cacaccacgg tgctcgactt cctgcgcgag cgcggcctca ccggcaccaa ggagggctgc       120
     gcggagggcg agtgcggcgc ctgttcggtc ctggtggcgc gcccgggggt gaacaagccc       180
     accgactggg tgccggtcaa cgcctgcctg gtgccggtcg cggcgctcga cgggcaggaa       240
     gtcgtcacct ccgagggcct cgccaccgtc gaggcgcccg gcacgccgcc cgtcctgcac       300
     ccggtgcagg aggagatggc ggtccgcggc ggctcccagt gcggttactg caccccgggg       360
     ttcgtctgca gcatggcggc cgagtactac cgtcccgacc gctgcgcgca cgccgacccg       420
     ggcccggacg cgaccgccgc cgccgacggc gccgaaggcg gcgacgccga gcacggtccg       480
     aacggcttcg acctgcacgc gctcagcggc aacctgtgcc gctgcaccgg ctaccggccg       540
     atccgcgacg cagccttcgc cgtcggcacg cccaccgacg aggacccgct ggcccggcgc       600
     cgcgagcagg acccgcccgc accggtcgcc accgaatacc gccaggacga cagcgccttc       660
     ctgcgccgga gcaccctggc cgagaccctg cggctgctgc gcgagcggcc ccaggcggtg       720
     gtggtcgcgg gcagtaccga ctggggcgtc gaggtcaaca tccgctcccg gcgggcggat       780
     tgcgtggtcg ccgtcgaccg gctgcccgaa ctgcgcgatc tgcgggtcga gtccgaccac       840
     gtcgagatcg gggccgcgct cacgctcacc gagatcgaac gccgcctgga cggcagcgtt       900
     ccgctgctgg cgcagctgtt cccgcagttc gcgtcccggc tcatccgcaa cggcgcgacc       960
     ctcggcggca acctgggcac cggctcgccc atcggcgaca gcccgccggt gctgctcgcg      1020
     ctggaggcgt cgctggtgct cgccgacgcc gacggggagc gcgaggtccc gctggccgac      1080
     tacttcaccg gctaccggca gagcgtgcgc cgtcccggcg agctgatccg cgccgtacgc      1140
     gtgccgctgc cgctgtctcc ggtcacggcc ttccacaaga tcgccaagcg gcgcttcgac      1200
     gacatctcca gcctggcggt cgccttcgcg ctcgacgtcg agggcggcac cgtccgcaag      1260
     gcccgcatcg ggctcggcgg cgtggccgcc accccggtcc gcgcgctcgc caccgaggcc      1320
     gccctggagg gccggccctg gaccaccggg accgccgagg ccgcggccga ggtgctgcgg      1380
     ggcgagggca cgccgatgag cgaccaccgg gccagcgccc gctaccgggc cgcgatgctc      1440
     ggccagagcc tgctgaagct gtacgcacag accaccgagg cggtgccgtc atga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page