(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4973

AL939122.SCO4973     Location/Qualifiers
FT   CDS_pept        40107..40928
FT                   /transl_table=11
FT                   /gene="SCO4973"
FT                   /gene_synonym="2SCK31.33"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.33, conserved hypothetical protein, len: 273
FT                   aa; similar to TR:Q9RYX5 (EMBL:AE001862) Deinococcus
FT                   radiodurans conserved hypothetical protein DRA0179, 274 aa;
FT                   fasta scores: opt: 888 z-score: 1076.8 E(): 0; 52.4%
FT                   identity in 271 aa overlap"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG9"
FT                   /protein_id="CAD30958.1"
FT                   /translation="MTWIAAVARLRARREPGVLVTVATVRGHAPRDAGAKLVVGRTGTW
FT                   GSIGGGNVEAVAVDRAREMIAAAAPEPEMLDFALNDKVTNRHGVQCCGGTVAVLLEPLP
FT                   VVRAVAVFGVGHVGLELARILARQDIDLHLVDSRAELLTEERLGVLSDAVAQVHTHHTP
FT                   LLPEEVLAELPPGTHVLIMTHDHAEDAALCDAALRTDHLGSIGLIGSAAKWARFRKRLA
FT                   GEGDHDDALIDRIKTPIGLADITGKEPATIAVSVAADLLRTFEADFEADRP"
     atgacctgga tcgccgcggt cgcgcggttg cgggcccgcc gggagcccgg cgtgctggtg        60
     accgtcgcga ccgtgcgcgg ccacgccccg cgtgacgccg gtgccaaact cgtcgtgggg       120
     cggaccggga cctggggctc gatcggtggc ggcaacgtcg aggcagtcgc cgtcgaccgg       180
     gcccgggaga tgatcgcggc ggccgcaccg gaaccggaga tgctggactt cgccctcaac       240
     gacaaggtga ccaaccggca cggcgtgcag tgctgcggcg gcaccgtcgc cgtgctgctc       300
     gaaccgctgc cggtggtccg ggcggtggcg gtcttcggcg tcgggcacgt cggtctggaa       360
     ctggcccgga tcctggcccg tcaggacatc gacctccacc tggtcgacag ccgcgccgag       420
     ctcctgaccg aggagcggct cggcgtgctg tcggacgccg tggcgcaggt gcacacgcac       480
     cacacgccgc tgctgccgga ggaggtgctg gccgagctgc cgcccggcac ccacgtcctg       540
     atcatgaccc acgaccacgc cgaggacgcc gccctgtgcg acgccgccct gcgcacggac       600
     catctggggt ccatcggact gatcggctcg gcggccaagt gggcgcgctt ccgcaagcgc       660
     ctcgccggcg agggcgacca cgacgacgcc ctcatcgacc ggatcaagac cccgatcggg       720
     ctggccgaca tcaccggcaa ggagcctgcg accatcgccg tgagcgtggc ggccgacctg       780
     ctgcgcacct tcgaggcgga cttcgaggcg gaccggccct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page