(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4974

AL939122.SCO4974     Location/Qualifiers
FT   CDS_pept        41121..41624
FT                   /transl_table=11
FT                   /gene="SCO4974"
FT                   /gene_synonym="2SCK31.34"
FT                   /product="putative deaminase"
FT                   /note="2SCK31.34, possible deaminase, len: 167 aa; similar
FT                   to TR:AAG05887 (EMBL:AE004677) Pseudomonas aeruginosa
FT                   probable deaminase PA2499, 151 aa; fasta scores: opt: 299
FT                   z-score: 372.9 E(): 3.1e-13; 36.6% identity in 123 aa
FT                   overlap. Contains Pfam match to entry PF00383
FT                   dCMP_cyt_deam, Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /db_xref="GOA:Q9ADJ9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADJ9"
FT                   /protein_id="CAD30959.1"
FT                   /translation="MTTDTLETGIREFERAWMDKAIELATTSVRNGGGPFGALIAKGGE
FT                   IVALGNNQVTAGLDPTAHAEVSAIRAACKALDTFSLEGCTLVTSCEPCPMCLSSALWAR
FT                   VDRLVFSADRHDAAVAGFDDRKFYDLFEKRPQANWPMTVEHLDLPHRTQPFDAWIAKTD
FT                   RVDY"
     atgacgaccg acaccctcga aaccggcatc cgcgagttcg agcgcgcctg gatggacaag        60
     gccatcgagc tggccaccac cagcgtccgc aacggcggcg gccccttcgg cgccctgatc       120
     gccaagggcg gtgagatcgt cgccctcggc aacaaccagg tgaccgccgg cctcgacccc       180
     accgcgcacg ccgaggtcag cgccatccgc gccgcctgca aggcgctcga cacgttcagc       240
     ctggaaggct gcacgctcgt cacgtcctgc gagccctgcc cgatgtgcct ctcctcggcc       300
     ctgtgggccc gggtcgaccg cctcgtcttc tccgccgacc gccacgacgc cgccgtggcc       360
     ggcttcgacg accgcaagtt ctacgacctg ttcgagaagc gcccgcaggc gaactggccc       420
     atgaccgtgg aacacctcga cctgccccac cgcacccagc cgttcgacgc ctggatcgcc       480
     aagaccgacc gcgtcgacta ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page