(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4975

AL939122.SCO4975     Location/Qualifiers
FT   CDS_pept        41702..43762
FT                   /transl_table=11
FT                   /gene="SCO4975"
FT                   /gene_synonym="2SCK31.35"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.35, conserved hypothetical protein, len: 680
FT                   aa; similar to SW:YYAL_BACSU (EMBL:D26185) Bacillus
FT                   subtilis hypothetical 78.8 kDa protein in TetB-ExoA
FT                   intergenic region YyaL, 689 aa; fasta scores: opt: 1541
FT                   z-score: 1751.9 E(): 0; 39.2% identity in 683 aa overlap.
FT                   Contains match to Prosite entry PS00133 Zinc
FT                   carboxypeptidases, zinc-binding region 2 signature"
FT                   /db_xref="GOA:Q9EWH0"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWH0"
FT                   /protein_id="CAD30960.1"
FT                   /translation="MRKDGGMPNRLAQATSPYLLQHAENPVDWWPWEAEAFEEARRRGV
FT                   PVLLSVGYSACHWCHVMAHESFEDGPTAEYLNSHFVSVKVDREERPDVDAVYMEAVQAA
FT                   TGQGGWPMTVFLTPDAEPFYFGTYFPPEPRHGMPSFRQVLQGVQQAWAERRDEVDEVAG
FT                   KIVRDLAGREISYGDAEAPGEEQLGQALLGLTREYDERRGGFGGAPKFPPSMVIEFLLR
FT                   HHARTGAEGALQMAADTCERMARGGIYDQLGGGFARYSVDREWVVPHFEKMLYDNALLC
FT                   RVYAHLWRATGSDLARRVALETADFMVRELRTAEGGFASALDADSDDGTGKHVEGAHYV
FT                   WTPAQLTEVLGAEDAELAAQYFGVTQEGTFEHGASVLQLPQQESVFDAARIASVRERLL
FT                   AARDGRPAPGRDDKVVAAWNGLAVAALAETGAYFERPDLVEAAVAAADLLVRLHLDEQV
FT                   RLTRTSKDGRAGANAGVLEDYADVAEGFLALASVTGEGVWLDFAGFLLDHVLTRFTDES
FT                   GSLYDTAADAERLIRRPQDPTDNATPSGWSAAAGALLSYAAHTGSAPHRAAAERALGVV
FT                   KALGPRVPRFIGWGLAAAEALLDGPREVAVVAPDPADPAARGLHRTALLGTAPGAVVAF
FT                   GTEGSDEFPLLADRPLVGGAPAAYVCRNFTCDAPTTDPDRLRTALGVAPTG"
     gtgcgcaagg atggaggcat gcccaaccga cttgcgcagg cgacgtcccc ctacctcctc        60
     cagcacgcgg agaacccggt cgactggtgg ccgtgggagg ccgaggcgtt cgaagaagcc       120
     cggcggcgcg gcgtccccgt cctgctgagc gtcggctaca gcgcgtgtca ctggtgccac       180
     gtcatggcgc acgagtcgtt cgaggacggg cccaccgccg agtacctcaa ctcgcacttc       240
     gtcagcgtca aggtcgaccg cgaggagcgc cccgacgtcg acgccgtcta catggaggcc       300
     gtgcaggcgg ccaccggtca gggcggctgg cccatgaccg tgttcctcac gcccgacgcg       360
     gagcccttct acttcggcac ctacttcccg cccgagcccc ggcacggcat gccctccttc       420
     cgccaggtgc tccagggcgt ccagcaggcc tgggcggaac ggcgcgacga ggtcgacgag       480
     gtcgccggga agatcgtgcg ggacctcgcc ggacgggaga tctcctacgg cgacgccgag       540
     gcgccgggcg aggagcagct cgggcaggcg ctgctcgggc tcacccggga gtacgacgag       600
     cggcgcggcg ggttcggcgg ggcgccgaag ttcccgccgt ccatggtgat cgagttcctg       660
     ctgcgccacc acgcccgcac cggcgccgag ggcgcgctcc agatggcggc cgacacctgc       720
     gagcggatgg cccgcggcgg catctacgac cagctgggcg gcggcttcgc ccgctactcc       780
     gtggaccgcg agtgggtcgt gccgcacttc gagaagatgc tgtacgacaa cgcgctgctg       840
     tgccgcgtgt acgcccacct gtggcgggcc accggctcgg acctcgcccg ccgggtcgcg       900
     ctggagaccg ccgacttcat ggtgcgggaa ctgcgcaccg ccgagggcgg gttcgcctcc       960
     gcgctggacg ccgacagcga cgacgggaca gggaagcacg tggagggcgc ccactacgtg      1020
     tggacgcccg cgcagctcac cgaggtcctc ggcgccgagg acgcggaact ggccgcgcag      1080
     tacttcggcg tgacccagga gggcaccttc gagcacggcg cctccgtgct ccaactgccg      1140
     cagcaggaaa gcgtcttcga cgccgcgcgg atcgcgtcgg tgcgggagcg gctgctcgcg      1200
     gcgcgggacg ggcgccccgc cccgggccgg gacgacaagg tggtcgccgc ctggaacggc      1260
     ctggcggtcg ccgccctcgc cgagaccggc gcctacttcg aacgccccga cctggtcgag      1320
     gccgccgtcg ccgccgccga cctgctggtg cgcctgcacc tggacgagca ggtcaggctc      1380
     acccgcacca gcaaggacgg ccgggccgga gccaacgccg gagtgctgga ggactacgcc      1440
     gacgtggccg agggcttcct cgcgctggcg tcggtcaccg gggagggcgt ctggctggac      1500
     ttcgccggct tcctgctcga ccacgtactc acccgcttca cggacgagtc cggctcgctg      1560
     tacgacaccg cggccgacgc cgagcggctg atccgccgcc cgcaggaccc caccgacaac      1620
     gccaccccgt ccggctggag cgccgccgcg ggcgccctgc tctcgtacgc agcgcacacc      1680
     ggctccgcac cccaccgcgc cgccgccgag cgcgccctcg gcgtggtgaa ggcgctcggc      1740
     ccgcgcgtcc cgcgcttcat cggctggggg ctggcggccg ccgaggcgct gctcgacggc      1800
     ccgcgcgagg tcgccgtggt cgccccggac ccggccgacc ccgccgcgcg cgggctgcac      1860
     cgtacggcac tgctcgggac cgcgcccggg gcggtcgtcg ccttcgggac cgagggcagc      1920
     gacgagttcc cgctgctcgc cgaccggccc ctggtgggcg gggcaccggc cgcctacgtc      1980
     tgccggaact tcacctgcga cgcaccgacc accgacccgg accggctgcg cacggcactg      2040
     ggcgtcgccc cgaccggctg a                                                2061
//

If you have problems or comments...

PBIL Back to PBIL home page