(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4977

AL939122.SCO4977     Location/Qualifiers
FT   CDS_pept        complement(44535..45242)
FT                   /transl_table=11
FT                   /gene="SCO4977"
FT                   /gene_synonym="2SCK31.37c"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="2SCK31.37c, probable tetR-family transcriptional
FT                   regulator, len: 235 aa; similar to SW:TCMR_STRGA
FT                   (EMBL:M80674) Streptomyces glaucescens tetracenomycin C
FT                   transcriptional repressor TcmR, 226 aa; fasta scores: opt:
FT                   304 z-score: 354.3 E(): 3.4e-12; 37.2% identity in 218 aa
FT                   overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 46..67 (+5.26 SD)"
FT                   /db_xref="GOA:Q9EWH2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="PDB:2OF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWH2"
FT                   /protein_id="CAD30962.1"
FT                   /translation="MTAARSAPSPAGAPRPGLRERKKTRTREAIRAATYGLIRQQGYEA
FT                   TTVEQIAERAEVSPSTVLRYFPTREDIVLTDEYDPVMAAELAARPAGEPWSDSLRHVLR
FT                   KALGLGAGEEAELIRLRTRLLAEVPAVRARMLENMSDTGRMLARAIADRTGLDPDGLEV
FT                   RIVSMSLVGGLMEVSRYWAEHDHEESLAELVDRALDALENGLPALRESDRESDREGDRG
FT                   GHREDRREGPRKD"
     atgaccgccg cacgttccgc cccctccccc gccggggccc cgcggccggg cctgcgggag        60
     cggaagaaga ccaggacccg tgaggcgatc cgcgccgcga cctacgggct gatccgtcag       120
     caggggtacg aggccacgac ggtcgagcag atcgccgagc gcgccgaagt gtcgccgtcg       180
     accgtgctgc gctacttccc gaccagggag gacatcgtcc tcacggacga gtacgacccg       240
     gtcatggccg cggaactcgc cgcccggccc gcgggcgaac cgtggtcgga ctccctgcgg       300
     cacgtgctgc gcaaggccct cggcctcggc gccggtgagg aggccgagct gatccggctg       360
     cggacacggc tgctggccga ggtccccgcg gtgcgggcgc gcatgctgga gaacatgtcg       420
     gacaccggcc ggatgctcgc ccgcgccatc gccgaccgca ccggtctcga cccggacggc       480
     ctcgaggtca ggatcgtgtc gatgtccctg gtcggcggcc tgatggaggt ctccaggtac       540
     tgggccgagc acgaccacga ggagagcctg gcagagctgg tcgaccgcgc cctggacgcc       600
     ctggagaacg ggctccccgc cctccgggaa agcgaccggg aaagcgatcg ggagggcgac       660
     cggggaggcc atcgggagga ccgtcgggag ggccctcgaa aagactga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page