(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4979

AL939122.SCO4979     Location/Qualifiers
FT   CDS_pept        46288..48117
FT                   /transl_table=11
FT                   /gene="SCO4979"
FT                   /gene_synonym="2SCK36.02"
FT                   /product="putative phosphoenolpyruvate carboxykinase"
FT                   /note="2SCK36.02, probable phosphoenolpyruvate
FT                   carboxykinase, len: 609 aa; similar to SW:PPCK_CHLLI
FT                   (EMBL:S56812) Chlorobium limicola phosphoenolpyruvate
FT                   carboxykinase [GTP] (EC 4.1.1.32) PckA, 646 aa; fasta
FT                   scores: opt: 2400 Z-score: 2689.0 bits: 507.7 E():
FT                   3.6e-142; 58.361% identity in 598 aa overlap. Contains Pfam
FT                   match to entry PF00821 PEPCK, Phosphoenolpyruvate
FT                   carboxykinase and match to Prosite entry PS00505
FT                   Phosphoenolpyruvate carboxykinase (GTP) signature"
FT                   /db_xref="GOA:Q93JL5"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93JL5"
FT                   /protein_id="CAC40592.1"
FT                   /translation="MARDIAAPPVPTNHQELISWVNEIAELTQPDAVVWCDGSEAEYER
FT                   LCGELVEKGTFRKLDPIKRPNSYYAASDPTDVARVEDRTFICSAKEEDAGPTNHWKDPA
FT                   EMRAIFTGDKGEGGLFRGSMRGRTMYVVPFCMGPLGSPLSALGVEITDSAYVAASMRTM
FT                   TRMGQPVLDELGDEGFFVKAVHSVGAPLEPGQADVPWPCNSTKYISHFPEDREIWSYGS
FT                   GYGGNALLGKKCYALRIASVMARDEGWLAEHMLVLKLTPPTGAPKYVAAAFPSACGKTN
FT                   LAMLEPTISGWTVETIGDDIAWMRFGEDGRLYAINPEAGFFGVAPGTGEHTNANAMKTL
FT                   WGNSVFTNVALTDDGDVWWEGMTEETPAHLTDWKGNDWTPESGTPAAHPNARFTTPAAQ
FT                   CPIIAPEWEDPRGVPISAILFGGRRATAVPLVTESFDWNHGVFLGANVASEKTAAAEGK
FT                   VGELRRDPFAMLPFCGYNMGDYMGHWVDVAKDKDQSKLPKIYYVNWFRKDDAGRFVWPG
FT                   FGENGRVLKWIVERLEGRADGVETPIGVLPTKESLDTDGLDLADADLEFLLSVDKEVWR
FT                   EEAALVPEHLNTFGDHTPAELWDQYRALVRRLG"
     gtggcgcgcg acatcgcggc tccccccgtc cccaccaacc accaggaact gatctcgtgg        60
     gtgaacgaga tcgccgaact gacccagccg gacgcagtgg tctggtgcga cggatccgag       120
     gccgagtacg agcgcctgtg cggggagctc gtcgagaagg gcaccttccg caaactcgac       180
     ccgatcaagc gccccaactc gtactacgcg gcctccgacc ccaccgacgt cgcgcgcgtc       240
     gaggaccgga ccttcatctg ctccgccaag gaggaggacg ccggccccac caaccactgg       300
     aaggaccccg ccgagatgcg ggccatcttc accggtgaca agggagaagg cgggctgttc       360
     cgcggctcca tgcgcggccg gaccatgtac gtcgtgccct tctgcatggg ccccctcggc       420
     tccccgctct ccgcgctcgg cgtcgagatc accgactccg cgtacgtcgc cgcctccatg       480
     cgcaccatga cccgcatggg acagccggtc ctggacgagc tgggcgacga gggcttcttc       540
     gtcaaggccg tgcactccgt cggcgccccg ctggagcccg gccaggcgga cgtcccctgg       600
     ccctgcaaca gcaccaagta catctcgcac ttccccgagg accgcgagat ctggtcctac       660
     ggctccggct acggcggcaa cgccctgctc ggcaagaagt gctacgccct gcgcatcgcc       720
     tccgtcatgg cccgcgacga gggctggctc gccgagcaca tgctggtgct gaagctgacg       780
     ccgcccaccg gtgcgcccaa gtacgtcgcc gccgccttcc cgtcggcctg cggcaagacc       840
     aacctcgcca tgctggagcc cacgatctcc ggctggaccg tggagaccat cggcgacgac       900
     atcgcctgga tgcgcttcgg cgaggacggc cgcctgtacg ccatcaaccc cgaggcgggc       960
     ttcttcggtg tcgcgcccgg caccggtgag cacaccaacg ccaacgccat gaagaccctg      1020
     tggggcaatt cggtcttcac caacgtcgcc ctgaccgacg acggcgacgt gtggtgggag      1080
     ggcatgaccg aggagacccc ggcccacctc accgactgga agggcaacga ctggacgccc      1140
     gagtccggca ccccggccgc gcaccccaac gcccgtttca ccacgcccgc cgcgcagtgc      1200
     ccgatcatcg cgccggagtg ggaggacccc aggggcgtgc cgatctcggc gatactcttc      1260
     ggcgggcgcc gcgccaccgc cgtaccgctg gtcaccgagt ccttcgactg gaaccacggc      1320
     gtcttcctcg gcgccaacgt ggcctccgag aagaccgccg ccgccgaggg caaggtcggc      1380
     gagctgcgcc gcgacccctt cgccatgctg ccgttctgcg gctacaacat gggcgactac      1440
     atggggcact gggtcgacgt ggccaaggac aaggaccagt ccaagctgcc gaagatctac      1500
     tacgtcaact ggttccgcaa ggacgacgcg ggcaggttcg tctggcccgg cttcggcgag      1560
     aacggccgcg tcctgaagtg gatcgtggag cgcctggagg gcagggccga cggcgtcgag      1620
     accccgatcg gcgtgctgcc gaccaaggag tccctcgaca ccgacggact cgacctcgcc      1680
     gacgccgacc tggagttcct gctcagcgtg gacaaggagg tctggcgcga ggaggcggca      1740
     ctcgtccccg agcacctgaa caccttcggc gaccacacgc ccgccgagct gtgggaccag      1800
     taccgggcgc tggtgcggcg cctgggctga                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page