(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4980

AL939122.SCO4980     Location/Qualifiers
FT   CDS_pept        complement(48400..49350)
FT                   /transl_table=11
FT                   /gene="SCO4980"
FT                   /gene_synonym="2SCK36.03c"
FT                   /product="hypothetical protein 2SCK36.03c"
FT                   /note="2SCK36.03c, unknown, len: 316 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL4"
FT                   /protein_id="CAC40593.1"
FT                   /translation="MSGDGLEGLLAAVHRLTAQRMGPPVCGTAGHGTGHVCLVPPAGAG
FT                   LPGIEEAIGSRFGEPLRLVTGTTTEAAGGSAGLPLRTPFGERIVEMRAWAYGDRWIGCG
FT                   TVRADDADGAVRPVVLVAERADPAAGASAPATWVDGIVAVTGWETARARAVDWPAVEAR
FT                   LGTPLPGDYKRLVEIFGGAGAFDGYLQLQVPDAHDRSTDLVRHTEWLGEWARTHGSRLW
FT                   EPYPVYPAPGGLLQWASTEQADGFYWLTGDPDPDRWPVLAKEDVPDSWERFDGPTGEFV
FT                   HRMLTEPDHPFSTARWFDVHWYQDYGPAAADEGRV"
     gtgagcgggg acggtctcga ggggctgctg gcggccgtcc accggctgac cgcgcagcgc        60
     atgggcccgc cggtgtgcgg gacggcgggg cacggcacgg ggcacgtgtg cctggtgccg       120
     cccgcggggg ccgggctgcc cggtatcgag gaagcgatcg gctcgcggtt cggggagccg       180
     ctccgcctcg tcaccggcac caccaccgag gcggcgggcg ggtcggccgg gctgccgctc       240
     cgcacgccgt tcggggagcg gatcgtcgag atgcgggcgt gggcgtacgg ggaccggtgg       300
     atcggctgcg gcacggtgcg cgccgacgac gcggacggtg ccgtccggcc cgtggtgctc       360
     gtcgccgagc gggcggaccc cgcggcaggg gcgagcgcgc ccgcgacctg ggtggacggg       420
     atcgtcgccg tcaccgggtg ggagacggcg cgggcccggg cggtcgactg gccggcggtg       480
     gaggcacggc tcgggacgcc gctgcccggc gactacaagc ggctcgtcga gatcttcggc       540
     ggcgccggtg ccttcgacgg ctacctgcaa ctccaggtgc ccgacgcgca cgaccggagc       600
     acggacctcg tccggcacac cgagtggctc ggggagtggg cccgcacgca cggcagccgc       660
     ctgtgggagc cgtacccggt gtatccggct cccggcgggc tgctgcagtg ggcgagcacc       720
     gagcaggcgg acgggttcta ctggctcacc ggggaccccg acccggacag gtggcccgta       780
     ctggcgaagg aggacgtccc cgactcctgg gagcggttcg acggtccgac cggggagttc       840
     gtccaccgca tgctcaccga gccggaccac ccgttctcca cggcccgctg gttcgacgtc       900
     cactggtacc aggactacgg accggcggcc gcggacgagg gccgggtctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page