(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4981

AL939122.SCO4981     Location/Qualifiers
FT   CDS_pept        complement(49347..50747)
FT                   /transl_table=11
FT                   /gene="SCO4981"
FT                   /gene_synonym="2SCK36.04c"
FT                   /product="putative bifunctional protein"
FT                   /note="2SCK36.04c, possible bifunctional protein, len: 466
FT                   aa; N-terminal region presents low similarity to N-terminal
FT                   region of TR:O14362 (EMBL:Z97992) Schizosaccharomyces pombe
FT                   putative glucan synthase-1 (EC 2.4.1.34) SPBC30D10.17c, 504
FT                   aa; fasta scores: opt: 176 Z-score: 188.3 bits: 44.3 E():
FT                   0.0071; 24.931% identity in 361 aa overlap and C-terminal
FT                   region to C-terminal region of TR:AAK22951 (EMBL:AE005774)
FT                   Caulobacter crescentus oxidoreductase, GFO/IDH/MOCA family
FT                   CC0967, 307 aa; fasta scores: opt: 146 Z-score: 160.2 bits:
FT                   38.4 E(): 0.26; 26.590% identity in 173 aa overlap"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL3"
FT                   /protein_id="CAC40594.1"
FT                   /translation="MSSIHDFATWEPLLRLVRASHPERLAGPGGHVMGQIGLGGWSVPV
FT                   RRPHPAPGRASLVEDMQDEFTAVEAVQAALRAHGRQSVSFMVETRVDGRTALHVVDSGP
FT                   AVEHGLVSPFVGTLVLVEGAVPEPWRRLPEAVPGALPAPSADPALLERTLRERLPDAVG
FT                   ATEAEIAEAQTRLGVTLPDELKALYRVVRARWQDWRGDYAAQERVVDAVGCELLPLDQL
FT                   YVADARSRPCLWQFAATDAAVTAPDAAVQGLVGSPGWIAFGDNGGGDRLALDLTPGPGG
FT                   HTGQVVMIGHEDSIGAGLLAESLTDMVVNGRAEWHPGRDWDRPPVVARLNVLGDDVSAV
FT                   ARPELEVLVLGGREGEPRSLAPLAGLPRLRTLHACPGALADPLEIAGLTRLEYLRLGPE
FT                   EWRVLLDAGAVPRSLLAAHIEVRGEHHPPRIIALANELLSLWDRPLISRTVLEGDLDTD
FT                   RTAQGGAR"
     ttgtcctcga tacacgactt cgcgacctgg gagccgttgc tgcggctcgt gcgggcgtcc        60
     cacccggagc ggctcgccgg gcccgggggt cacgtcatgg ggcagatcgg tctcggcggg       120
     tggagcgtgc ccgtgcggcg gccgcacccc gcaccggggc gcgcgtcgct ggtggaggac       180
     atgcaggacg agttcaccgc cgtggaggcg gtccaggccg ccctgagggc ccacggcagg       240
     caatccgtgt cgttcatggt cgagacgcgc gtggacggga ggaccgcgct ccacgtcgtc       300
     gactccggcc ccgccgtgga gcacggcctc gtcagcccct tcgtcgggac cctggtgctg       360
     gtcgaggggg cggtccccga gccctggcgg cggctgcccg aagcggtgcc gggggcgctc       420
     ccggcaccgt cggcggaccc cgcgctgctg gagcggaccc tgcgcgagcg gctacccgac       480
     gccgtcggtg cgaccgaggc ggagatcgcc gaggctcaga cccgcctcgg tgtcacgctg       540
     cccgacgagc tcaaggcgct ctaccgcgtg gtccgggcac ggtggcagga ctggcgcggc       600
     gactacgcgg cacaggagcg cgtcgtcgac gcggtcggct gtgagctgct ccccctggac       660
     cagttgtacg tcgcggacgc acggtcccgc ccgtgcctgt ggcagttcgc cgccacggac       720
     gccgccgtca ccgcaccgga cgccgccgtg cagggcctcg tcggctcgcc cggctggatc       780
     gccttcggcg acaacggcgg cggcgaccgg ctcgccctcg acctgacccc ggggccgggc       840
     gggcacaccg ggcaggtcgt catgatcggc cacgaggaca gcatcggcgc cggactgctc       900
     gccgagtccc tcaccgacat ggtggtgaac ggccgggcgg agtggcaccc gggccgggac       960
     tgggacagac cgccggtggt cgcccggctg aacgtcctcg gcgacgacgt gtcggccgtc      1020
     gcccgtcccg agctggaggt actcgtgctc ggcgggcggg agggcgagcc gcgcagcctc      1080
     gccccgctcg ccggactccc ccggctgcgg accctccacg cctgcccggg cgcgctcgcc      1140
     gacccgctgg agatcgccgg gctgacgcgt ctggagtacc tgcgcctcgg ccccgaggag      1200
     tggcgcgtgc tgctcgacgc gggcgccgtc ccccggagtc tgctggcggc ccacatcgag      1260
     gtgcggggcg aacaccaccc gccgcggatc atcgccctcg ccaacgagct cctgtccctg      1320
     tgggaccgcc cgctgatcag ccggacggtc ctggaaggcg acctggacac cgaccggacg      1380
     gcgcagggcg gcgcccggtg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page