(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4983

AL939122.SCO4983     Location/Qualifiers
FT   CDS_pept        complement(51206..51628)
FT                   /transl_table=11
FT                   /gene="SCO4983"
FT                   /gene_synonym="2SCK36.06c"
FT                   /product="hypothetical protein 2SCK36.06c"
FT                   /note="2SCK36.06c, unknown, len: 140 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL1"
FT                   /protein_id="CAC40596.1"
FT                   /translation="MYEPIRSKSVHSTMAGTTTDFPGRSRDDELDIQLAGHLAALLAVT
FT                   DELRALAPDTGLDAAAERLAEQVTRLRGGQAPVRLQVAATRQEPRPAALHRRAHTLAAR
FT                   ALVVAASRADTAVAILTAERMDAHSAALEPRPLASR"
     atgtacgagc cgatccgcag caagtcggtc cacagcacga tggccggcac caccacggac        60
     ttccccggcc gatcccggga cgatgagctg gacatccagc tcgccggcca tctcgcggcg       120
     ctgctcgccg tcaccgacga actgcgcgcg ctggcgcccg acaccggcct ggacgccgcc       180
     gccgagcggc tggccgagca ggtgacccgg ctgcggggag gtcaggcgcc ggtccggctg       240
     caggtcgccg ccacccgcca ggagccgcgt ccggcggccc tgcaccggcg ggcgcacacc       300
     ctggcggccc gcgccctggt ggtcgcggcc tcccgcgccg acacggcggt cgcgatcctg       360
     accgccgagc gcatggacgc gcactccgcg gccctggagc cgcgcccgct cgcgtcccgc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page