(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4984

AL939122.SCO4984     Location/Qualifiers
FT   CDS_pept        complement(51700..52911)
FT                   /transl_table=11
FT                   /gene="SCO4984"
FT                   /gene_synonym="2SCK36.07c"
FT                   /product="putative aminotransferase"
FT                   /note="2SCK36.07c, probable aminotransferase, len: 403 aa;
FT                   similar to many, e.g. TR:O86587 (EMBL:AL031514)
FT                   Streptomyces coelicolor putative aminotransferase
FT                   SC2H4.04c, 402 aa; fasta scores: opt: 1881 Z-score: 2193.7
FT                   bits: 414.8 E(): 1.4e-114; 65.920% identity in 402 aa
FT                   overlap. Contains Pfam match to entry PF00155 aminotran_1,
FT                   Aminotransferase class-I"
FT                   /db_xref="GOA:Q93JL0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL0"
FT                   /protein_id="CAC40597.1"
FT                   /translation="MQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPAAF
FT                   GFECPPEILEDILRNVSTAHGYGDAKGLLAARRAVVMHNQTLGIETDVEHVFIGNGVSE
FT                   LIVMAMQGLLDDGDEVLVPAPDYPLWTAAVSLSGGTAVHYRCDEQSDWMPDLADVERKI
FT                   TDRTKALVIINPNNPTGAVYDDAMLRGLTDIARRHNLLVCSDEIYDKILYDDATHTPTA
FT                   AIAPDLLTLTFNGMSKAYRVAGYRVGWMSISGPRAHAESYIEGLTILANMRLCANMPGQ
FT                   HGVVAALSGRQTINELVLPGGRLREQRDAAHEALTSIPGVTCVKPKGALYLFPRLDPKV
FT                   FKIKDDRRMVLDLLRQEKIMVVQGTGFNWPEPDHFRVVTLPTAADLREAVDRIGNFLDG
FT                   YSQP"
     atgcaggtga tccagtcgac caagctcgcc aacgtctgtt acgagatccg gggcccggtg        60
     ctcgaggagg cgatgcggct ggaggcggcc gggcaccgca tcctgaagct gaacaccggc       120
     aatccggcag ccttcggctt cgagtgcccg ccggagattt tggaggacat cctccgcaac       180
     gtctccacgg cgcacggcta cggcgacgcg aagggcctgc tggcggcgcg ccgggcggtc       240
     gtcatgcaca accagaccct cggcatcgag acggacgtcg agcacgtctt catcggcaac       300
     ggcgtctccg agctgatcgt gatggcgatg cagggcctgc tcgacgacgg cgacgaggtc       360
     ctcgtcccgg cccccgacta cccgctgtgg acggccgccg tctcactgtc cggcggtacg       420
     gcggtgcact accgctgcga cgagcagtcc gactggatgc ccgacctcgc ggacgtggag       480
     cggaagatca ccgaccgcac caaggccctg gtgatcatca atccgaacaa cccgacgggc       540
     gcggtctacg acgacgcgat gctgcgcgga ctgacggaca tcgcccgccg gcacaacctg       600
     ctggtctgct cggacgagat ctacgacaag atcctctacg acgacgccac ccacaccccg       660
     accgccgcga tcgcccccga cctgctcacc ctcaccttca acggcatgtc gaaggcgtac       720
     cgggtggccg gttaccgggt cggctggatg tcgatctccg ggccgcgcgc gcacgccgag       780
     tcctacatcg agggcctgac gatcctggcg aacatgcgcc tgtgcgccaa catgccgggc       840
     cagcacggcg tggtcgcggc gctcagcggg cggcagacca tcaacgagct ggtgctgccg       900
     ggcgggcggc tgcgcgagca gcgcgacgcc gcccacgagg cactgaccag cattcccggc       960
     gtgacctgcg tgaagccgaa gggtgcgctg tacctcttcc cgcggctcga ccccaaggtc      1020
     ttcaagatca aggacgaccg gcggatggtc ctggacctgc tgcgccagga gaagatcatg      1080
     gtcgtccagg gcaccggctt caactggccc gagcccgacc acttccgggt ggtgaccctg      1140
     ccgacggccg cggacctgcg cgaggcggtg gaccggatcg ggaacttcct ggacgggtac      1200
     agccagccct ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page