(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4985

AL939122.SCO4985     Location/Qualifiers
FT   CDS_pept        53145..53999
FT                   /transl_table=11
FT                   /gene="SCO4985"
FT                   /gene_synonym="2SCK36.08"
FT                   /product="hypothetical protein 2SCK36.08"
FT                   /note="2SCK36.08, unknown, len: 284 aa"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK9"
FT                   /protein_id="CAC40598.1"
FT                   /translation="MNKPLLAALATLAVTGVGVAPAAASPAAPAASASPAAPAVRAVSF
FT                   AGTVALSNCSGSVVRLPASEDDDPALVMSNGHCLETGFPAAGEVVVDQPSSRTFGLLNA
FT                   SGTRVGTLRAGKIAYATMTDTDVSLYQLTSTYAQIRGSYGISPLTLDDTRPTAGTAITV
FT                   VSGYWKRTYACNVDGFAYRLKEGEWTWKDSVRYTSACRTIGGTSGSPVVDNATGKVVAV
FT                   NNTGNEDGGRCTDNNPCEVAEDGTVTVREGINYGQQTYRIPACFALDNKLDLSRSGCAL
FT                   PKP"
     atgaacaagc ctctccttgc cgcgctcgcc accctggccg tcaccggggt cggcgtggca        60
     ccggcggccg cgtcacccgc ggctcccgcg gcttccgcgt cacccgcggc tcccgccgtc       120
     cgcgccgtgt ccttcgccgg caccgtcgcg ctcagcaact gctccggctc ggtcgtgcgc       180
     ctgcccgcct ccgaggacga cgacccggcg ctggtcatgt ccaacggcca ctgcctggag       240
     accggcttcc cggcggccgg cgaggtcgtc gtggaccagc cctccagccg caccttcggg       300
     ctgctcaacg cctccggcac ccgcgtcggc accctgcggg ccggcaagat cgcctacgcg       360
     acgatgaccg acacggacgt ctcgctctac cagctcacca gcacgtacgc ccagatccgc       420
     ggctcctacg ggatcagccc gctcaccctc gacgacaccc gtcccacggc cggcaccgcg       480
     atcaccgtcg tctccggcta ctggaagcgc acctatgcct gcaacgtcga cgggttcgcc       540
     taccgcctga aggaggggga atggacctgg aaggactcgg tccgctacac ctccgcctgc       600
     cggaccatcg gcggcacctc cggatcaccg gtcgtcgaca acgccaccgg caaggtcgtc       660
     gccgtcaaca acacgggcaa cgaggacggc gggcgctgca ccgacaacaa cccctgcgag       720
     gtcgccgagg acggcaccgt cacggtccgc gagggcatca actacggcca gcagacctat       780
     cggatccccg cctgcttcgc cctcgacaac aagctcgacc tctcgcgcag cggctgcgcc       840
     ctgcccaagc cgtag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page