(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4986

AL939122.SCO4986     Location/Qualifiers
FT   CDS_pept        complement(54037..55647)
FT                   /transl_table=11
FT                   /gene="SCO4986"
FT                   /gene_synonym="2SCK36.09c"
FT                   /product="putative D-aminoacylase"
FT                   /note="2SCK36.09c, probable D-aminoacylase, len: 536 aa;
FT                   similar to SW:NDAD_ALCXX (EMBL:S80683) Alcaligenes
FT                   xylosoxydans D-aminoacylase (EC 3.5.1.81) Dan, 483 aa;
FT                   fasta scores: opt: 370 Z-score: 413.6 bits: 86.1 E():
FT                   2e-15; 33.647% identity in 532 aa overlap"
FT                   /db_xref="GOA:Q93JK8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK8"
FT                   /protein_id="CAC40599.1"
FT                   /translation="MEELVIRDADVVDGSGGDSYRADVVVDGGRIVSIVKEAAAAGCQR
FT                   PEARRELDAEGLVLSPGFIDMHAHSDLALLRDPDHSAKAAQGVTLEVIGQDGLSYAPVD
FT                   DRTLGEVRRAIAGWNGHGDDVDFDWRSVGEYLDRLDRGIAVNAAYLIPQGTVRALAVGW
FT                   DDREATEAELEHMRRLVAEGLEQGAVGLSSGLTYTPGMYAKDAELTELCRVVASYGGYY
FT                   CPHHRSYGAGALKAYEEMVELTREAGCPLHLAHATMNFGVNKGKAPELLTLLDEALAGG
FT                   ADITLDTYPYTPGCTTLVALLPSWASEGGPEQILKRLADDDTAERIRHHMEVIGSDGSH
FT                   GVPMEWETIEISGTGDPALAEYVGRTVLESARLRGESPWTVARHLLLADRLAPTILQHV
FT                   GHEENVRAIMRHRVHTGGSDGILQGAKPHPRAYGTFPHYLGHYVRELGVLPLEECVAHL
FT                   TSRPAARLRLPDRGLVREGYRADLVLFDPATVAAGSSFDEPRVLPTGIPYVLVDGRFVM
FT                   EDGRRTDVLAGRSVRRVPR"
     atggaagagc tggtcatcag ggacgccgac gtcgtggacg gctccggcgg cgactcctac        60
     cgagccgacg tcgtggtcga cggcggccgg atcgtctcga tcgtcaagga ggcggcggcc       120
     gccggctgcc agcgccccga ggcacgccgg gagctggacg ccgagggcct ggtcctgtcc       180
     cccggcttca tcgacatgca cgcccacagc gacctggcgc tgctgcggga cccggaccac       240
     agcgccaagg ccgcccaggg cgtcaccctg gaggtcatcg gccaggacgg gctgtcgtac       300
     gcaccggtcg acgaccgcac cctcggcgag gtgcgccggg cgatcgccgg gtggaacggc       360
     cacggggacg acgtcgactt cgactggcgg tcggtcggcg agtacctgga ccggctcgac       420
     cggggcatcg cggtcaacgc cgcgtacctg atcccgcagg gcacggtgcg cgccctcgcc       480
     gtcggctggg acgaccggga ggcgaccgag gcggagctgg agcacatgcg gcgcctggtc       540
     gccgagggcc tggagcaggg cgcggtcggc ctgtcgtcgg ggctgaccta cacgcccggg       600
     atgtacgcca aggacgccga gctgaccgag ctgtgccggg tggtggcgtc gtacggcggc       660
     tactactgcc cgcaccaccg ctcgtacggg gcgggggccc tgaaggcgta cgaggagatg       720
     gtggagctga cccgggaggc gggctgcccg ctgcacctgg cgcacgccac catgaacttc       780
     ggcgtgaaca agggcaaggc gcccgagctg ctgaccctgc tcgacgaggc actcgcgggc       840
     ggcgccgaca tcaccctcga cacctacccg tacacccccg gctgcaccac cctcgtggca       900
     ctgctgccga gctgggcgag cgagggcgga ccggagcaga tcctgaagcg gctggcggac       960
     gacgacaccg ccgagcgcat ccggcaccac atggaggtga tcggctccga cggctcccac      1020
     ggcgtgccca tggagtggga gacgatcgag atctccggca cgggcgaccc ggcgctcgcc      1080
     gagtacgtcg gccgcacggt gctggagtcg gcgcggctgc gcggcgagag cccgtggacg      1140
     gtcgcccggc acctgctgct cgccgaccgg ctggcgccga ccatcctcca gcacgtcggc      1200
     cacgaggaga acgtgcgcgc gatcatgcgg caccgggtcc acaccggcgg ctcggacggc      1260
     atcctccagg gcgccaagcc gcacccgcgc gcctacggca ccttcccgca ctacctgggc      1320
     cactacgtgc gcgagctggg cgtgctcccg ctggaggagt gcgtggccca cctcacctca      1380
     cgcccggcgg cccggctgcg gctgccggac cggggtctgg tccgcgaggg gtaccgggcc      1440
     gacctggtgc tcttcgaccc ggccacggtg gccgcgggca gctcgttcga cgagccgcgg      1500
     gtgctgccta cgggcatccc gtacgtgctg gtcgacgggc gtttcgtgat ggaggacggg      1560
     cggcgcaccg acgtgctggc cggacggtcg gtgcgccggg ttccgcgctg a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page