(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4987

AL939122.SCO4987     Location/Qualifiers
FT   CDS_pept        complement(55676..56977)
FT                   /transl_table=11
FT                   /gene="SCO4987"
FT                   /gene_synonym="2SCK36.10c"
FT                   /product="putative D-amino acid deaminase"
FT                   /note="2SCK36.10c, possible D-amino acid deaminase, len:
FT                   433 aa; similar to TR:Q45085 (EMBL:AF158699) Burkholderia
FT                   cepacia D-serine deaminase Dsd, 432 aa; fasta scores: opt:
FT                   919 Z-score: 1026.2 bits: 199.0 E(): 1.5e-49; 41.259%
FT                   identity in 429 aa overlap. Contains match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK7"
FT                   /protein_id="CAC40600.1"
FT                   /translation="MALDNGPAGGREALAELAEERVDHRFKGLPPDAYGLTLAELAGQR
FT                   RNLFTGGFTTPVLALSAERLEHNLKLMETYSARHGLAFAPHGKTSMAPQLFHRQIEHGA
FT                   WGITLAVPHQVRVARAFGVQRVFLANELVDAAALRWISAELDADPGFRFVCYADSVRGV
FT                   ELMDAALTDAGAARPLDVVVELAAGAGARTGVRTEAGCAAVADAVAGARTLRLAGVAGY
FT                   EGEVPDADPERVHAWLRRLVALAVDFDRAGRFDGLEEIVLSAGGSAWFDAVADVFAEVP
FT                   GLSLPVLKLLRSGAYVSHDDGHYRELTPFNRVPEEGALEPAFRLWSQVVSRPSPEQAFT
FT                   NAGKRDAAYDLHLPFAQVVRPADGGPERPATGVEVTGLSDQHAWLRTSGEADLAVGDWV
FT                   GAGLSHPCTSFDKWQLIPVAQADGTVVDYIRTFF"
     atggccctcg acaacggccc cgcaggcggc cgcgaagccc tcgccgagct ggccgaggag        60
     cgtgtcgacc accgcttcaa gggcctcccg ccggacgcct acggcctgac cctcgccgag       120
     ctggccggac agcgccgcaa cctcttcacc ggcggtttca ccacccccgt cctcgcgctg       180
     tccgccgagc gcctggagca caacctgaag ctcatggaga cgtactccgc ccggcacggc       240
     ctcgccttcg cgccgcacgg caagacctcc atggcaccgc agctcttcca ccgccagatc       300
     gagcacggcg cctggggcat caccctggcc gtgccgcacc aggtacgggt ggcgcgggcg       360
     ttcggcgtcc agcgggtctt cctggccaac gagctggtcg acgccgccgc cctgcgctgg       420
     atctccgccg agctggacgc cgaccccggc ttccgcttcg tctgctacgc cgactccgtg       480
     cgcggcgtcg agctgatgga cgcggccctg acggacgcgg gcgccgcccg cccgctggac       540
     gtcgtggtcg agctggccgc cggtgcgggt gcccggaccg gcgtgcgcac cgaggccggg       600
     tgcgcggcgg tcgccgacgc ggtggccggc gcgcggacgc tgcggctggc cggggtcgcc       660
     gggtacgagg gcgaggtgcc ggacgccgac ccggagcgcg tgcacgcgtg gctgcggcgg       720
     ctggtcgcgc tggccgtcga cttcgacagg gccgggcggt tcgacgggct ggaggagatc       780
     gtgctgagcg cgggcggcag cgcctggttc gacgcggtcg ccgacgtgtt cgccgaggtc       840
     cccggcctct cgctgcccgt cctgaagctg ctgcgctcgg gcgcgtacgt ctcccacgac       900
     gacggccact accgcgagct gacccccttc aaccgggtcc ccgaggaggg cgccctggaa       960
     cccgcgttcc ggctgtggag ccaggtcgtc tcccgcccct cccccgagca ggcgttcacc      1020
     aacgcgggca agcgggacgc ggcgtacgac ctgcacctgc ccttcgccca ggtggtgcgc      1080
     cccgcggacg gcggcccgga gcgccctgcg accggcgtcg aggtgaccgg cctgtccgac      1140
     cagcacgcct ggctgcgcac gagcggggag gcggacctgg cggtgggcga ctgggtcggg      1200
     gcgggcctgt cccacccgtg cacctccttc gacaagtggc agctgatccc ggtcgcacag      1260
     gcggacggga cggtcgtcga ctacatccgc acgttcttct ag                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page