(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4989

AL939122.SCO4989     Location/Qualifiers
FT   CDS_pept        58166..58930
FT                   /transl_table=11
FT                   /gene="SCO4989"
FT                   /gene_synonym="2SCK36.12"
FT                   /product="putative IclR-family transcriptional regulatory
FT                   protein"
FT                   /note="2SCK36.12, probable IclR-family transcriptional
FT                   regulatory protein, len: 254 aa; similar to SW:KDGR_ECOLI
FT                   (EMBL:AE000277) Escherichia coli transcriptional regulator
FT                   KdgR, 263 aa; fasta scores: opt: 420 Z-score: 488.7 bits:
FT                   98.0 E(): 1.3e-19; 30.992% identity in 242 aa overlap.
FT                   Contains Pfam match to entry PF01614 IclR, Bacterial
FT                   transcriptional regulator and possible helix-turn-helix
FT                   motif at residues 20..41 (+3.12 SD)"
FT                   /db_xref="GOA:Q93JK5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK5"
FT                   /protein_id="CAC40602.1"
FT                   /translation="MSQTVDRALSILPLLAEGPADLGRVADRLGVHKSTALRLLRTLHD
FT                   HGFVYRQSDQRYRLGARLISLAQEAMENLDVREIAHPHLVRLNEQVGHTVHLAVHEEDE
FT                   VLYIDKVESRYPVRMYSRIGKPVAITVAAVAKLLLADLPEDERRAVAEQLDYPMYTARS
FT                   TPNADGFLKELAKVREQGWATDLGGHEESINCVAAPIRGADGRVVAAMSVSAPNVVVTA
FT                   DELLTLLPLVRRTADAISGEYSGRTPVKEVTA"
     atgagccaga ccgtcgaccg tgcgctcagc atcctgccgc tgctcgccga gggccccgcc        60
     gacctgggcc gggtcgccga ccgcctgggc gtgcacaagt ccacggccct gcggctgctg       120
     cgcaccctcc acgaccacgg cttcgtctac cgccagtccg accagcgcta ccgcctgggc       180
     gcccggctga tctccctcgc ccaggaggcg atggagaacc tcgacgtccg cgagatcgcc       240
     cacccccacc tcgtacgcct caacgaacag gtcggacaca ccgtccacct cgccgtccac       300
     gaggaggacg aggtcctcta catcgacaag gtcgagagcc gctacccggt ccgcatgtac       360
     tcccggatcg gcaagcccgt cgccatcacc gtcgcggccg tcgccaagct gctgctggcc       420
     gacctccccg aggacgagcg ccgggccgtg gccgagcagc tcgactaccc catgtacacg       480
     gcccgttcga caccgaacgc cgacgggttc ctcaaggaac tcgccaaggt gcgcgaacag       540
     ggctgggcca ccgacctcgg tggccacgag gagtccatca actgcgtcgc cgcgcccatc       600
     cggggcgccg acggccgggt ggtcgccgcc atgtcggtct ccgcgccgaa cgtggtcgtc       660
     accgcggacg aactcctcac cctgctcccg ctggtgcgcc gtacggcgga cgccatcagc       720
     ggcgagtact ccggcaggac cccagtcaag gaagtcaccg catga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page