(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4991

AL939122.SCO4991     Location/Qualifiers
FT   CDS_pept        59458..60936
FT                   /transl_table=11
FT                   /gene="SCO4991"
FT                   /gene_synonym="2SCK36.14"
FT                   /product="putative sugar transport integral membrane
FT                   protein"
FT                   /note="2SCK36.14, probable sugar transport integral
FT                   membrane protein, len: 492 aa; similar to SW:GNTP_BACSU
FT                   (EMBL:J02584) Bacillus subtilis gluconate permease GntP,
FT                   448 aa; fasta scores: opt: 988 Z-score: 1028.7 bits: 199.7
FT                   E(): 1.1e-49; 39.186% identity in 467 aa overlap. Contains
FT                   Pfam match to entry PF02447 GntP_permease, GntP family
FT                   permease and match to Prosite entry PS00017 ATP/GTP-binding
FT                   site motif A (P-loop). Also contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q93JK3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK3"
FT                   /protein_id="CAC40604.1"
FT                   /translation="MSYSSLRLAAAEAPPHTGGLLTLIDGTAGLLTVAAIGIALLLFLI
FT                   IKVRLQPFVALLAVSIAVGLLAGLSVTELFGTVQKSDAVSTIESGMGGILGHVAIIIGL
FT                   GTMLGAILEVSGGAQVLASRLLGLFGEKRAPLAMGLTGLIFGIPVFFDVGIFVLAPIVY
FT                   AAAKRSGKSILLYCLPLLAGLSMTHAFLPPHPGPVAAAGLLNVKLGWIILMGIVCGIPA
FT                   VLAAWVFSAWIGRRIFVPVPQDMVEASEEAKQAVIEEQRKAGVAPNESPVALGTVLGII
FT                   GTPLVLILAATFSSIALDPSTLRSVIEFFGNPFVALTIALLLAYYLLGIRRGWSRKSLE
FT                   TVSTASLKPVGNILLVVGAGGVFGAVLKASGVAQALSDTFNDVGLPVIVLAYLISVVLR
FT                   VAQGSATVAIVTTAGIVAPLLAEGDHSQAFVALVIMAISAGSIFASHVNDGGFWMVAKY
FT                   FGISERDTLKTWTVLESVLSVAGFVVAAVVSLFV"
     atgtcctact cgtccctccg tcttgccgcc gccgaggccc caccccacac cggcggtctg        60
     ctcaccctga tcgacggcac cgccggtctg ctgaccgtcg ccgccatcgg catcgcgctg       120
     ctgctcttcc tcatcatcaa ggtgcggctt cagcccttcg tcgcgctgct cgccgtctcc       180
     atagccgtcg gcctgctcgc cggcctgtcg gtcaccgaac tcttcggcac cgtgcagaag       240
     tcggacgccg tctcgaccat cgagtccggc atgggcggca tcctcggcca cgtcgccatc       300
     atcatcggcc tgggcaccat gctcggcgcg atcctcgaag tcagcggcgg cgcccaggtg       360
     ctggcctccc gcctgctcgg cctcttcggg gagaagcggg ccccgctcgc catgggcctc       420
     accggtctga tcttcggcat cccggtcttc ttcgacgtgg gcatcttcgt cctcgcgccc       480
     atcgtctacg ccgccgccaa gcgctccggc aagtcgatcc tgctctactg cctgccgctg       540
     ctggccggcc tgtccatgac ccacgccttc ctgccgccgc accccggccc ggtggccgcc       600
     gccggactgc tgaacgtcaa gctcggctgg atcatcctca tgggcatcgt ctgcggcatc       660
     cccgccgtcc tcgccgcctg ggtgttctcc gcctggatcg gccgccgcat cttcgtgccc       720
     gtgccgcagg acatggtcga ggcgtccgag gaggccaagc aggccgtcat cgaggagcag       780
     cgcaaggccg gcgtcgcgcc gaacgagagc cccgtcgcgc tcggcaccgt cctcggcatc       840
     atcggcaccc cgttggtcct gatcctcgcc gcgaccttct cctccatcgc cctggacccg       900
     tccaccctcc gctcggtgat cgagttcttc ggcaacccgt tcgtcgcgct gaccatcgcc       960
     ctgctcctcg cctactacct gctcggcatc cggcgcggct ggtcccgcaa gtccctggag      1020
     accgtctcga cggcctcgct gaagccggtc ggcaacatcc tgctggtggt cggcgcgggc      1080
     ggggtcttcg gcgccgtcct caaggccagc ggcgtcgccc aggcactctc cgacaccttc      1140
     aacgacgtcg gcctgccggt gatcgtcctc gcctacctga tctccgtggt gctgcgggtc      1200
     gcgcagggct cggcgacggt ggccatcgtg acgacggcgg gcatcgtggc gccgctgctg      1260
     gccgagggcg accactcgca ggcgttcgtc gcgctggtca tcatggccat ctcggcgggc      1320
     tccatcttcg cctcgcacgt caacgacggc ggcttctgga tggtcgccaa gtacttcggc      1380
     atcagcgagc gggacacgct caagacgtgg accgtgctgg agagcgtcct gtccgtcgcc      1440
     gggttcgtgg tggccgcggt ggtgagcctg ttcgtgtag                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page