(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4992

AL939122.SCO4992     Location/Qualifiers
FT   CDS_pept        61032..61676
FT                   /transl_table=11
FT                   /gene="SCO4992"
FT                   /gene_synonym="2SCK36.15"
FT                   /product="hypothetical protein 2SCK36.15"
FT                   /note="2SCK36.15, unknown, len: 214 aa. High content of
FT                   alanine and glutamic amino acid residues in C-terminal
FT                   region"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK2"
FT                   /protein_id="CAC40605.1"
FT                   /translation="MEQRRGSTSQPLEGAGFDPAFIPGLTAPVSGEPEDVRRAEDEAEK
FT                   DADAETEESSHSPAADEPPAEDAEDAEEPDAEAPVDGPVFEASDRRAKIVADHRGVRLS
FT                   LDDQACEFRWDEVGAVETETGRFGKRFTVTVHTPDRRWYPIEIEAASRSRFAEWESALD
FT                   EVLDAYFEDGEAESETEAEAVEAAETADTADTAEKDAEDAEGAEEAKARAE"
     gtggagcagc gcagaggatc gacgagccag cccctggaag gcgccggatt cgacccggca        60
     ttcatccccg ggctcaccgc acccgtgtcc ggtgagcccg aggacgtgag acgcgccgag       120
     gacgaggcgg agaaggacgc cgacgcggag accgaggagt cgtcgcactc cccggccgcc       180
     gacgagcccc ccgccgaaga cgccgaggac gccgaggaac cggatgccga ggcccccgtg       240
     gacggccccg tcttcgaggc ctccgaccgc cgtgccaaga tcgtcgccga ccacaggggc       300
     gtacgtctct ccctcgacga ccaggcctgt gagttccgct gggacgaggt cggggcggtc       360
     gagacggaga ccggccgctt cggcaagcgg ttcacggtca cggtgcacac gccggaccgc       420
     cgctggtacc cgatcgagat cgaggccgcc tcccgaagcc gtttcgccga gtgggaatcg       480
     gccctggacg aggtcctgga cgcgtacttc gaagacggcg aggcggagtc cgaaaccgaa       540
     gcggaggccg tagaggcggc agagacggcc gatacggcgg acacggcgga gaaggacgcc       600
     gaggacgccg agggcgccga ggaggccaag gcccgcgcgg agtaa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page