(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4993

AL939122.SCO4993     Location/Qualifiers
FT   CDS_pept        61696..63066
FT                   /transl_table=11
FT                   /gene="SCO4993"
FT                   /gene_synonym="2SCK36.16"
FT                   /product="putative metal ion transport protein"
FT                   /note="2SCK36.16, possible metal ion transport protein,
FT                   len: 456 aa; similar to SW:MNTH_SALTY (EMBL:AF161317)
FT                   Salmonella typhimurium manganese transport protein MntH,
FT                   413 aa; fasta scores: opt: 241 Z-score: 273.7 bits: 59.8
FT                   E(): 1.2e-07; 20.824% identity in 437 aa overlap. Contains
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q93JK1"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK1"
FT                   /protein_id="CAC40606.1"
FT                   /translation="MHALLSHRRPWAFLTPMADTTGNTSDAGVSVGADQAPRKSSWRYI
FT                   GPGIVVAATGVGAGDLVATLIAGSNFGYTLLWAAVIGCLVKISLAEACGRWHLATGRTL
FT                   FDGWASIGSWTTWFFAIYAVIWGFVYGAAAMSSSALPLQALFPDVMDLEWWGIACGLVG
FT                   LVFVWFNKYNVFEKVMTVLVGVMFVITVYLAIRVTPNLGDAFAGLLPVLPDEKDSVLNT
FT                   LGLIGGVGGTITLAAYGYWVNAKGWTTTGWMKVMRLDNRVAYATTGIFVVAMLLVGAEL
FT                   LHSANIAIASGDKGLIQLGDILEQEYGTATGKLFLIGFFATSFTSLIGVWHGVSLMFAD
FT                   FLARRRGEREARGDELASGRRERSWAFRAYLLWLTFPPMILLFQDEPFRLIIIYGVLGA
FT                   AFMPFLALTLMWLLNSSRTPREWRNGSLSNGMLAMAGLLFLVLCVKQIWDQPWSEFF"
     gtgcacgccc tcttgtcgca ccggcggcca tgggctttct tgacccccat ggcggacacc        60
     acgggcaaca cctcagacgc aggcgtatcg gtcggggccg atcaggcccc ccgtaagtcc       120
     agttggcgct acatcggccc ggggatcgtc gtcgccgcga ccggtgtggg tgccggcgac       180
     ctcgtggcca ccctcatcgc gggcagcaac ttcggctaca ccctgctgtg ggcggcggtc       240
     atcggctgcc tcgtgaagat ctccctcgcc gaggcgtgcg gccgctggca cctggccacc       300
     ggccgcaccc tcttcgacgg ctgggcgagc atcggctcct ggaccacgtg gttcttcgcg       360
     atctacgccg tgatctgggg cttcgtctac ggcgccgcgg cgatgtcgtc cagcgccctc       420
     cccctccagg ccctcttccc ggacgtgatg gacctcgaat ggtggggcat cgcctgcggc       480
     ctggtgggcc tggtcttcgt ctggttcaac aagtacaacg tcttcgagaa ggtcatgacc       540
     gtcctggtgg gcgtcatgtt cgtcatcacg gtgtacctgg cgatccgcgt caccccgaac       600
     ctgggcgacg ccttcgccgg actcctcccg gtcctcccgg acgagaagga ctcggtcctc       660
     aacaccctgg gcctgatcgg cggcgtgggc ggcaccatca cgctggccgc ctacggctac       720
     tgggtcaacg ccaagggctg gaccaccacc ggctggatga aggtcatgcg gctggacaac       780
     cgggtcgcct acgccaccac cggcatcttc gtcgtcgcga tgctcctcgt cggcgccgag       840
     ctgctgcact ccgccaacat cgcgatcgcg agcggcgaca agggcctgat ccagctcggc       900
     gacatcctgg agcaggagta cggcacggcg accggcaagc tcttcctgat cggcttcttc       960
     gccaccagct tcacctcgct gatcggcgtc tggcacggcg tgagcctgat gttcgccgac      1020
     ttcctggccc gccggcgcgg tgaacgggag gcgcggggcg acgagttggc ctcgggccgc      1080
     cgcgaacgct cctgggcctt ccgcgcctac ctgctctggc tgaccttccc gccgatgatc      1140
     ctgctgttcc aggacgagcc cttccgcctg atcatcatct acggcgtcct gggcgccgcc      1200
     ttcatgccct tcctcgccct caccctgatg tggctcctca actcctcgcg cacaccccgc      1260
     gaatggcgca acggcagcct cagcaacggc atgctcgcca tggccgggct gctgttcctg      1320
     gtcctgtgcg tgaagcagat ctgggaccag ccgtggtcgg agttcttctg a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page